(data stored in ACNUC7421 zone)

EMBL: CP002047.PE466

CP002047.PE466       Location/Qualifiers
FT   CDS             542638..543318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03587"
FT                   /db_xref="GOA:D7C096"
FT                   /db_xref="UniProtKB/TrEMBL:D7C096"
FT                   /protein_id="ADI03587.1"
FT                   /translation="MAKRAVHRRARKILGEDPVALVWCEIHKPIPTPPEDVHRASGKKR
FT                   LKPGRHWLRYIGAVVFFFVVIPMMLIDGLDRLLQGRRRRGPRAGEPQTPPEDRPAASRR
FT                   GPARDRRQDPTNGIFDGDWNLAAGQLLLRWYGHSPNPKRLVMLAHDRVCIATSPRRRLS
FT                   PTKADDFRTVVEFPLDQVRVEGEAGQPRGFATFRLRFTDGSWLEVGRLGEPEDADHFLR
FT                   TISG"
     MAKRAVHRRA RKILGEDPVA LVWCEIHKPI PTPPEDVHRA SGKKRLKPGR HWLRYIGAVV        60
     FFFVVIPMML IDGLDRLLQG RRRRGPRAGE PQTPPEDRPA ASRRGPARDR RQDPTNGIFD       120
     GDWNLAAGQL LLRWYGHSPN PKRLVMLAHD RVCIATSPRR RLSPTKADDF RTVVEFPLDQ       180
     VRVEGEAGQP RGFATFRLRF TDGSWLEVGR LGEPEDADHF LRTISG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page