(data stored in ACNUC7421 zone)

EMBL: CP002047.PE470

CP002047.PE470       Location/Qualifiers
FT   CDS             complement(546382..547440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00470"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03591"
FT                   /db_xref="GOA:D7C0A0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A0"
FT                   /protein_id="ADI03591.1"
FT                   /translation="MRLPYRPPPTPETTGDTALEIRGLRVEFSEPGHASATPAVDGLDL
FT                   TVRRGEIVALVGESGSGKTMTALSAIGLLPPGARVTGGRITLGEEDLATLPPKRMNRVR
FT                   GHRLAMLFQQPKAMLDPTCTVGSQVAEPLRLHRGLSRRQARARVVELLRDVGIPEPERR
FT                   ASAYAHQLSGGMAQRVMIAAALAADPAMMIADEPTTALDATVQAQILRLLRHKQRESGM
FT                   AVLLITHDLTIVTSIADRVAVMYAGRVVEEGSVREVFDAPEHPYTRALLKASLLQSEEG
FT                   KLFAIPGSATQSRALDHGCRFQPRCPLSQDLGIAGRCSGAEPPLHTCGGEHRCRCWASE
FT                   HGTELRGEAVGV"
     MRLPYRPPPT PETTGDTALE IRGLRVEFSE PGHASATPAV DGLDLTVRRG EIVALVGESG        60
     SGKTMTALSA IGLLPPGARV TGGRITLGEE DLATLPPKRM NRVRGHRLAM LFQQPKAMLD       120
     PTCTVGSQVA EPLRLHRGLS RRQARARVVE LLRDVGIPEP ERRASAYAHQ LSGGMAQRVM       180
     IAAALAADPA MMIADEPTTA LDATVQAQIL RLLRHKQRES GMAVLLITHD LTIVTSIADR       240
     VAVMYAGRVV EEGSVREVFD APEHPYTRAL LKASLLQSEE GKLFAIPGSA TQSRALDHGC       300
     RFQPRCPLSQ DLGIAGRCSG AEPPLHTCGG EHRCRCWASE HGTELRGEAV GV               352
//

If you have problems or comments...

PBIL Back to PBIL home page