(data stored in ACNUC7421 zone)

EMBL: CP002047.PE471

CP002047.PE471       Location/Qualifiers
FT   CDS             complement(547454..548149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00471"
FT                   /product="transcriptional regulator protein"
FT                   /note="COG1802 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03592"
FT                   /db_xref="GOA:D7C0A1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A1"
FT                   /protein_id="ADI03592.1"
FT                   /translation="MPHDSTPAAPSATPVRRTTLAAQVVEQIRSRLLTGTFPPGSQLGE
FT                   AELAESLGVSRGPVREALARLVHEGLLLSEPHRGVFVPLLGEADVLDIYYAREALEAAA
FT                   FRRVITAPRPPGLLSALDETVDELARATRTGDWSKVADLDVRFHSLVIEAAGSPRLRRM
FT                   FDTVIAETRLCLNLQADADPARLDLVDEHRELARLIAGDDVAAALATLAQHFEEATVTV
FT                   RNRLRAVRR"
     MPHDSTPAAP SATPVRRTTL AAQVVEQIRS RLLTGTFPPG SQLGEAELAE SLGVSRGPVR        60
     EALARLVHEG LLLSEPHRGV FVPLLGEADV LDIYYAREAL EAAAFRRVIT APRPPGLLSA       120
     LDETVDELAR ATRTGDWSKV ADLDVRFHSL VIEAAGSPRL RRMFDTVIAE TRLCLNLQAD       180
     ADPARLDLVD EHRELARLIA GDDVAAALAT LAQHFEEATV TVRNRLRAVR R                231
//

If you have problems or comments...

PBIL Back to PBIL home page