(data stored in ACNUC7421 zone)

EMBL: CP002047.PE472

CP002047.PE472       Location/Qualifiers
FT   CDS             complement(548139..549044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00472"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03593"
FT                   /db_xref="GOA:D7C0A2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A2"
FT                   /protein_id="ADI03593.1"
FT                   /translation="MALSSSLSRDPVPSTAPRRLAHLTATGLRAVTGRHWTLRIGAVVL
FT                   ALVLTVLLLTPWIAPYDPAHQDLGQRLSGPGAHHLLGTDQLGRDILSRLMYGGRFSVSI
FT                   AAVTLLLSAVIGTVIGAFSARRGGIVDEVVMRTTDLLISIPDVIVALFLIAAFGTGYGM
FT                   LIAALTIVGWTPFARLMRGLALEINSREYIEAAEALGCSKVFIVFRHVIPNALRPVLSL
FT                   GFLRFGHKLITVGGLSYVGLGVQPPDSDWGAMLLDAQPYMQRLPLLVIAPGAAIFVTAL
FT                   SVTLIGHGMELKRKRRTDAS"
     MALSSSLSRD PVPSTAPRRL AHLTATGLRA VTGRHWTLRI GAVVLALVLT VLLLTPWIAP        60
     YDPAHQDLGQ RLSGPGAHHL LGTDQLGRDI LSRLMYGGRF SVSIAAVTLL LSAVIGTVIG       120
     AFSARRGGIV DEVVMRTTDL LISIPDVIVA LFLIAAFGTG YGMLIAALTI VGWTPFARLM       180
     RGLALEINSR EYIEAAEALG CSKVFIVFRH VIPNALRPVL SLGFLRFGHK LITVGGLSYV       240
     GLGVQPPDSD WGAMLLDAQP YMQRLPLLVI APGAAIFVTA LSVTLIGHGM ELKRKRRTDA       300
     S                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page