(data stored in ACNUC7421 zone)

EMBL: CP002047.PE474

CP002047.PE474       Location/Qualifiers
FT   CDS             complement(550024..551301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00474"
FT                   /product="putative oxidoreductase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03595"
FT                   /db_xref="GOA:D7C0A4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A4"
FT                   /protein_id="ADI03595.1"
FT                   /translation="MKTVPYWLDTAPPGPDRSAAEVGGRTDVAIVGAGLTGLSAALHLA
FT                   RKGAQVTVLEQESVGWGASGRNGGMCTTGLAIGFLTAVQRYGIPTAKAAYLAYNEAIDT
FT                   VEKLVVEEEIDCDFSRTGKLNLAAKPAHYERLARTHEALADLIGYPTQLIPKKDIRSEV
FT                   GSDHYHGAMADPQGAGLHVGKFVRGLAEAAAAQGVRILEKAPVTRARRVSGTAHDLTTP
FT                   VGTLRADQVLVATSGYTGSPFRWLRNRIIPVGSFIIVTEPLRQEVVDELMPTRRMASDS
FT                   KNILYYFRITPDNRLLFGGRARFAMSNPQSDRKSGQILRKGMLSVFPQLDGVRIDYLWG
FT                   GLVDISLDQMVHSGERDGLFYSVGYSGHGVQMATHMGRQMADVMDGRPEANIWRGMKFP
FT                   RVPGHFGPPWFLPFAGAYYRALDIIK"
     MKTVPYWLDT APPGPDRSAA EVGGRTDVAI VGAGLTGLSA ALHLARKGAQ VTVLEQESVG        60
     WGASGRNGGM CTTGLAIGFL TAVQRYGIPT AKAAYLAYNE AIDTVEKLVV EEEIDCDFSR       120
     TGKLNLAAKP AHYERLARTH EALADLIGYP TQLIPKKDIR SEVGSDHYHG AMADPQGAGL       180
     HVGKFVRGLA EAAAAQGVRI LEKAPVTRAR RVSGTAHDLT TPVGTLRADQ VLVATSGYTG       240
     SPFRWLRNRI IPVGSFIIVT EPLRQEVVDE LMPTRRMASD SKNILYYFRI TPDNRLLFGG       300
     RARFAMSNPQ SDRKSGQILR KGMLSVFPQL DGVRIDYLWG GLVDISLDQM VHSGERDGLF       360
     YSVGYSGHGV QMATHMGRQM ADVMDGRPEA NIWRGMKFPR VPGHFGPPWF LPFAGAYYRA       420
     LDIIK                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page