(data stored in ACNUC7421 zone)

EMBL: CP002047.PE476

CP002047.PE476       Location/Qualifiers
FT   CDS             complement(552017..553486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00476"
FT                   /product="putative ABC transporter substrate-binding
FT                   protein"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03597"
FT                   /db_xref="GOA:D7C0A6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A6"
FT                   /protein_id="ADI03597.1"
FT                   /translation="MGGQTSSGGGATGARSIVVDEPFAPAANWALETDDSFVLSKAGCL
FT                   ETLVKYQTGGGIKPMLAASWKQTRPTTWDFTLRPGVTFQDGTPLDAKAVAGALKHALAA
FT                   KTPAPGFSPETIAAVTAVDGSTVRITTPAPDALLPYRLAAPNTGILAPKAYTGSSTNPE
FT                   GTCTGPFRITKEIPQQAIQLKRNPKYWNGPVKLASAEVRFIADGAKRATQIQTGEAQIS
FT                   RKLPVPSVQDLKGNSSVEVLTEQLPRTTELVLNNKKAPFDNEKVRQAFQAAIDTKAITN
FT                   AVYQGAGQQAVGPFGPGEPWTPDGAAPVKADPAKAKALLSEAGVKPESIKVSLIAYNEG
FT                   SGFSDLAAIIQQELKAIGVKASIRTADYASVEPDLLSGDFDAALLSRNHLGDMPDPLGY
FT                   LTADYTCKGSYNLSHYCDPKTDGLIKKAASAKDPDTRYADYAKVAAELQSRAVDVFLVH
FT                   ETESVAVASGLKGFAVHPYYTLTANLSLGTK"
     MGGQTSSGGG ATGARSIVVD EPFAPAANWA LETDDSFVLS KAGCLETLVK YQTGGGIKPM        60
     LAASWKQTRP TTWDFTLRPG VTFQDGTPLD AKAVAGALKH ALAAKTPAPG FSPETIAAVT       120
     AVDGSTVRIT TPAPDALLPY RLAAPNTGIL APKAYTGSST NPEGTCTGPF RITKEIPQQA       180
     IQLKRNPKYW NGPVKLASAE VRFIADGAKR ATQIQTGEAQ ISRKLPVPSV QDLKGNSSVE       240
     VLTEQLPRTT ELVLNNKKAP FDNEKVRQAF QAAIDTKAIT NAVYQGAGQQ AVGPFGPGEP       300
     WTPDGAAPVK ADPAKAKALL SEAGVKPESI KVSLIAYNEG SGFSDLAAII QQELKAIGVK       360
     ASIRTADYAS VEPDLLSGDF DAALLSRNHL GDMPDPLGYL TADYTCKGSY NLSHYCDPKT       420
     DGLIKKAASA KDPDTRYADY AKVAAELQSR AVDVFLVHET ESVAVASGLK GFAVHPYYTL       480
     TANLSLGTK                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page