(data stored in ACNUC7421 zone)

EMBL: CP002047.PE477

CP002047.PE477       Location/Qualifiers
FT   CDS             complement(553869..554825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00477"
FT                   /product="cation efflux system protein"
FT                   /note="COG0053 Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03598"
FT                   /db_xref="GOA:D7C0A7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A7"
FT                   /protein_id="ADI03598.1"
FT                   /translation="MVKPHSHEAADKVDSAMESSAEGMRALWLSLAILGATAVFQTVVV
FT                   LISGSVALLGDTIHNFADAMTALPLGVAFVLGRRVANRTFTYGYGRAEDLAGIVIVLTI
FT                   AASAALAAYEAIDRLMNPRDISHLGIVSIAAVVGFIGNEWVARYRIRVGRKIGSAALVA
FT                   DGLHARTDGFTSLAVLLGAGGAALGWQLADPIVGLLITAAILLVLKDATREVFRRLMDS
FT                   VDPTLVDKGEAAVREVPGVRDVSELRMRWIGHKLRAEATVEVDGGLSVRESHAVAVDVE
FT                   HALIHAVPRLTAALVHTDPALGPDADDPHLALAHHMT"
     MVKPHSHEAA DKVDSAMESS AEGMRALWLS LAILGATAVF QTVVVLISGS VALLGDTIHN        60
     FADAMTALPL GVAFVLGRRV ANRTFTYGYG RAEDLAGIVI VLTIAASAAL AAYEAIDRLM       120
     NPRDISHLGI VSIAAVVGFI GNEWVARYRI RVGRKIGSAA LVADGLHART DGFTSLAVLL       180
     GAGGAALGWQ LADPIVGLLI TAAILLVLKD ATREVFRRLM DSVDPTLVDK GEAAVREVPG       240
     VRDVSELRMR WIGHKLRAEA TVEVDGGLSV RESHAVAVDV EHALIHAVPR LTAALVHTDP       300
     ALGPDADDPH LALAHHMT                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page