(data stored in ACNUC7421 zone)

EMBL: CP002047.PE478

CP002047.PE478       Location/Qualifiers
FT   CDS             complement(555178..556629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00478"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03599"
FT                   /db_xref="GOA:D7C0A8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0A8"
FT                   /protein_id="ADI03599.1"
FT                   /translation="MVEVLVPHLTDLFGNPSSNHPYGAEPGRRWPSPGHRSPLRDATAP
FT                   PTATGRDMTRPAPDADTTGPISDTPDTPETTHTAQAQRRILRVLVASQILSGAGLAAGV
FT                   TVGALLAQDMLGTSSLAGLPSGLFTAGSALAAVAVGRISQARGRRPGLATGYLTGAIGS
FT                   AGVITAAVLDTSVLLFIALFVYGAGTATNLQARYAGADLAQPNHRARAVSTVLVATTLG
FT                   GVAGPNLAAPTGDLAETLGIPHLAGPFMLGGAAYALAALVLAIWLRPDPLLTARTLAAA
FT                   EQSSNSATDTSPATDAAHERRGGVVLGALVMILTQLVMVAIMTMTPVHMHDHGHGTAAS
FT                   GLVIAIHIGAMYLPSPITGRLVDRYGPPKIAAASGLTLLAAGILAATAPGDSVALLALA
FT                   LALLGLGWNFGLVSGTAIITDTVPLATRAKTQGTVDVSIAIAGATGGLSSGIVVATASY
FT                   PILALTGGVLALAILPAIAATASSR"
     MVEVLVPHLT DLFGNPSSNH PYGAEPGRRW PSPGHRSPLR DATAPPTATG RDMTRPAPDA        60
     DTTGPISDTP DTPETTHTAQ AQRRILRVLV ASQILSGAGL AAGVTVGALL AQDMLGTSSL       120
     AGLPSGLFTA GSALAAVAVG RISQARGRRP GLATGYLTGA IGSAGVITAA VLDTSVLLFI       180
     ALFVYGAGTA TNLQARYAGA DLAQPNHRAR AVSTVLVATT LGGVAGPNLA APTGDLAETL       240
     GIPHLAGPFM LGGAAYALAA LVLAIWLRPD PLLTARTLAA AEQSSNSATD TSPATDAAHE       300
     RRGGVVLGAL VMILTQLVMV AIMTMTPVHM HDHGHGTAAS GLVIAIHIGA MYLPSPITGR       360
     LVDRYGPPKI AAASGLTLLA AGILAATAPG DSVALLALAL ALLGLGWNFG LVSGTAIITD       420
     TVPLATRAKT QGTVDVSIAI AGATGGLSSG IVVATASYPI LALTGGVLAL AILPAIAATA       480
     SSR                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page