(data stored in ACNUC7421 zone)

EMBL: CP002047.PE480

CP002047.PE480       Location/Qualifiers
FT   CDS             complement(557516..558466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00480"
FT                   /product="ycaO protein"
FT                   /note="COG1944 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03601"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B0"
FT                   /protein_id="ADI03601.1"
FT                   /translation="MRREWTHHPFATSTNGLASGNSTAEAALHALYEVIERDAVARLTT
FT                   LPRAERPRLDLPSVDDPDCAELLDRFGAAGVSVTAFDATWPPGEGGTGVPCYHVSVWSP
FT                   DLPVVVPGSGCHGAPEVALARALTEAAQGRLTVISGSRDDLSDRLYALQADPAKGAPRL
FT                   APSLRTVPLRPRETGHDLAEESRTVAAGVTTLTGTEPVLVEPGRPAGDARVCGGPGPRL
FT                   LLGPRRTARRPDAGTAARDPGLGVRPADRGPGPAAQPRAEPARLSRLPGLLRPAAHLLH
FT                   GALGHRSVRQRDPVLPLARLKTVEPFALRERELQR"
     MRREWTHHPF ATSTNGLASG NSTAEAALHA LYEVIERDAV ARLTTLPRAE RPRLDLPSVD        60
     DPDCAELLDR FGAAGVSVTA FDATWPPGEG GTGVPCYHVS VWSPDLPVVV PGSGCHGAPE       120
     VALARALTEA AQGRLTVISG SRDDLSDRLY ALQADPAKGA PRLAPSLRTV PLRPRETGHD       180
     LAEESRTVAA GVTTLTGTEP VLVEPGRPAG DARVCGGPGP RLLLGPRRTA RRPDAGTAAR       240
     DPGLGVRPAD RGPGPAAQPR AEPARLSRLP GLLRPAAHLL HGALGHRSVR QRDPVLPLAR       300
     LKTVEPFALR ERELQR                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page