(data stored in ACNUC7421 zone)

EMBL: CP002047.PE481

CP002047.PE481       Location/Qualifiers
FT   CDS             complement(558527..559732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00481"
FT                   /product="hypothetical protein"
FT                   /note="COG5520 O-Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03602"
FT                   /db_xref="GOA:D7C0B1"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B1"
FT                   /protein_id="ADI03602.1"
FT                   /translation="MAATPAVGASAAAATVIVDPSAVRQTIRGFGGMNHTVWISDLTPA
FT                   QRDTAFGNGEGQLGFSVLRIPVHENRADWSREVATAKRAIEYGAAVIASPWNPPAQMVE
FT                   TFVHGDQSNAKRLRYDMYGAYAQHLNDFCRFMKDNGVSLYAISVQNEPDYAHDWTWWTP
FT                   TEMIRFLRENAGSIEIKVIAPESFQYVKSFSDPILNDPTALANLDILGAHLYGTPYQNF
FT                   PYPLFKEKGRGKELWMTEVYYPNSSDSADLWPQALDVAEHIHHALVDAEFQAYVWWYIR
FT                   RSYGPMREDGRISKRGATMAHFSKFVRPGYVRIDATSNPQSNLYVLAYKGGDSKVVIIA
FT                   INKGTSSVSQPFTLVNNTSSSVSSWLTDASRNLASLGAMSVSNGSFTGQLPARSVTTFV
FT                   TG"
     MAATPAVGAS AAAATVIVDP SAVRQTIRGF GGMNHTVWIS DLTPAQRDTA FGNGEGQLGF        60
     SVLRIPVHEN RADWSREVAT AKRAIEYGAA VIASPWNPPA QMVETFVHGD QSNAKRLRYD       120
     MYGAYAQHLN DFCRFMKDNG VSLYAISVQN EPDYAHDWTW WTPTEMIRFL RENAGSIEIK       180
     VIAPESFQYV KSFSDPILND PTALANLDIL GAHLYGTPYQ NFPYPLFKEK GRGKELWMTE       240
     VYYPNSSDSA DLWPQALDVA EHIHHALVDA EFQAYVWWYI RRSYGPMRED GRISKRGATM       300
     AHFSKFVRPG YVRIDATSNP QSNLYVLAYK GGDSKVVIIA INKGTSSVSQ PFTLVNNTSS       360
     SVSSWLTDAS RNLASLGAMS VSNGSFTGQL PARSVTTFVT G                           401
//

If you have problems or comments...

PBIL Back to PBIL home page