(data stored in ACNUC7421 zone)

EMBL: CP002047.PE482

CP002047.PE482       Location/Qualifiers
FT   CDS             560309..562027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00482"
FT                   /product="putative ABC transporter ATP-binding subunit"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03603"
FT                   /db_xref="GOA:D7C0B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B2"
FT                   /protein_id="ADI03603.1"
FT                   /translation="MTVPAMLLPALGNIGINYIAPLIVAKLVARIADDSGVSIGSTLPY
FT                   VLGFVGVLLLAELLWRIGIHCLNRVDAHGIEHLYVIGMDELFAKDAAFFHDNFAGSLTK
FT                   RVLSFASRFEEFIDTLTFSVVGSLVPLVFASVVLWSYDPLLVVGLLAMIALTALCAAPL
FT                   IRRRQKLVDQREEAIARVAGHVADSLMNMDTVRAFAAEEREAAEHRSRVAESRRLSLRS
FT                   WDYGNLRIDTLVAPMSVLTNTLGLLLAVALGGGSHGVEAVVVAFTYYSNATRIMFEFNQ
FT                   IYRRLESSMTEAAQFTELLLTSPTVLDPESPEPLRSEGAGVRFEKVAFAHAGAETLFDG
FT                   LDLAVPSGTRVGLVGRSGGGKTTLTQLLLRTTDIEAGRILIGGQDISRLRQADLRSLIA
FT                   YVPQDPAMFHRTLRDNIAFARPDATDSDIRRAAEAAHVTEFADALPDGFDTMVGERGVK
FT                   LSGGQRQRVALARAILRDAPILLLDEATSALDSESEVLVQEALWRLMEGRTALVVAHRL
FT                   STVAAMDQVVVLDRGRIAEQGTHQELLASDGTYAKLWQHQVGGFLDDSPAPADLR"
     MTVPAMLLPA LGNIGINYIA PLIVAKLVAR IADDSGVSIG STLPYVLGFV GVLLLAELLW        60
     RIGIHCLNRV DAHGIEHLYV IGMDELFAKD AAFFHDNFAG SLTKRVLSFA SRFEEFIDTL       120
     TFSVVGSLVP LVFASVVLWS YDPLLVVGLL AMIALTALCA APLIRRRQKL VDQREEAIAR       180
     VAGHVADSLM NMDTVRAFAA EEREAAEHRS RVAESRRLSL RSWDYGNLRI DTLVAPMSVL       240
     TNTLGLLLAV ALGGGSHGVE AVVVAFTYYS NATRIMFEFN QIYRRLESSM TEAAQFTELL       300
     LTSPTVLDPE SPEPLRSEGA GVRFEKVAFA HAGAETLFDG LDLAVPSGTR VGLVGRSGGG       360
     KTTLTQLLLR TTDIEAGRIL IGGQDISRLR QADLRSLIAY VPQDPAMFHR TLRDNIAFAR       420
     PDATDSDIRR AAEAAHVTEF ADALPDGFDT MVGERGVKLS GGQRQRVALA RAILRDAPIL       480
     LLDEATSALD SESEVLVQEA LWRLMEGRTA LVVAHRLSTV AAMDQVVVLD RGRIAEQGTH       540
     QELLASDGTY AKLWQHQVGG FLDDSPAPAD LR                                     572
//

If you have problems or comments...

PBIL Back to PBIL home page