(data stored in ACNUC7421 zone)

EMBL: CP002047.PE483

CP002047.PE483       Location/Qualifiers
FT   CDS             562206..563786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00483"
FT                   /product="DNA-binding protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03604"
FT                   /db_xref="GOA:D7C0B3"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B3"
FT                   /protein_id="ADI03604.1"
FT                   /translation="MEARAHAGWLDELLHEVRRQMARRTGADPRAVLDWLSRQIDADIA
FT                   LVGSAGAVETATARFPRQILPSLEPTLARLAGGQMAAAATEAGALQVRLEALGPRAPRP
FT                   VLVVAGTSAPTPDAASLVSHAGSVIALLDRAQDADTTFRGYQHKARQLRFAVFSALLAG
FT                   DITLARRMTTGAVPALLDAQRLRVYLLQCTPEDRDRLAQIHQDGSGYHGTGLMVHCPAF
FT                   KEHLICLVAEDADGADGADGADETEVADGADADPETAHGQGTVLRRLVRENPHYALGIS
FT                   SPYPLGATAEAYGQALHALAAARHTPERVGAYLGRTPLVPLLPHEDAGTWARAFLRPLG
FT                   STPRATLDITRLAVTFPRSAVARLLDISRNTVSHHLRRVETTLGLDLSDVRTRAALDLA
FT                   FCLSPGPQSDDSLGGSGGSGGSGGAYGRPTPTLDELLRTEPAHAWAREFLRPLQDTRGR
FT                   DLHTTLCAWIDANTDAQRTARHLGLSRNTVRAHLRAAEHLLSRDLLTTGSGIHDLVHAL
FT                   HITGLPSAG"
     MEARAHAGWL DELLHEVRRQ MARRTGADPR AVLDWLSRQI DADIALVGSA GAVETATARF        60
     PRQILPSLEP TLARLAGGQM AAAATEAGAL QVRLEALGPR APRPVLVVAG TSAPTPDAAS       120
     LVSHAGSVIA LLDRAQDADT TFRGYQHKAR QLRFAVFSAL LAGDITLARR MTTGAVPALL       180
     DAQRLRVYLL QCTPEDRDRL AQIHQDGSGY HGTGLMVHCP AFKEHLICLV AEDADGADGA       240
     DGADETEVAD GADADPETAH GQGTVLRRLV RENPHYALGI SSPYPLGATA EAYGQALHAL       300
     AAARHTPERV GAYLGRTPLV PLLPHEDAGT WARAFLRPLG STPRATLDIT RLAVTFPRSA       360
     VARLLDISRN TVSHHLRRVE TTLGLDLSDV RTRAALDLAF CLSPGPQSDD SLGGSGGSGG       420
     SGGAYGRPTP TLDELLRTEP AHAWAREFLR PLQDTRGRDL HTTLCAWIDA NTDAQRTARH       480
     LGLSRNTVRA HLRAAEHLLS RDLLTTGSGI HDLVHALHIT GLPSAG                      526
//

If you have problems or comments...

PBIL Back to PBIL home page