(data stored in ACNUC7421 zone)

EMBL: CP002047.PE484

CP002047.PE484       Location/Qualifiers
FT   CDS             564355..568719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03605"
FT                   /db_xref="GOA:D7C0B4"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B4"
FT                   /protein_id="ADI03605.1"
FT                   /translation="MNTPEAEPAPAAAASGAAPDVQARPGPSADPKFATLKKDVQRKKR
FT                   SVASSHPPPKAEAGAAQDAARPPKDDEEAQGKTANAEKMNEAQPKDFDKDAFIKAVEKA
FT                   IAEKAPKNLDEADKFADSGKADEVRAEVHGKVGEGKADSAEQISTTTAAPPDTSAAVPK
FT                   KVVPMTPDRPPGTPGTPNPGNAVPDKLPPSATDLSAGPAQVDRQMTDAQVTETQLKKSN
FT                   EPTFKNALGEKKAAEQHSAVAPGRMRGHEKKELRAATAQAQRLGAAAMGAIGAQRVRTG
FT                   QQVGAGKTGAKGRDEEKRAQVTAVLQGVFDTMKKEVEAILDGLDKLVDDQFGREEKAAR
FT                   DAFTAEHKRKMEEYKDRRYSGWTGKARWVKDLFAGLPAEADKIFEAARDNYVRRMRQVI
FT                   SDVADTIGSELNRAKRRIAQGRTELQAAVRKLPADLRSIGQQAAAEFSDKFDELTQSVD
FT                   DKGTQLVDTLATKYTDALKSVDDEIAAEKEKNKGLVAKAVDAVKSVINTILELKRLLLS
FT                   VLAKAASAVMLILKDPIGFLRNLVSAVGAGLKQFLANIGRHLQQGIMSWLLGKTAEAGI
FT                   ELPSKFDAQGVLRMLASLLGLTWQNIRARIVRKVPKMEPAVAAAETAVPLVAEVRKRGV
FT                   AGMWDDLKTRVGDLKKDLLDKVIAYVTPTIVVAGIMWVISLLNPASAFVRAVKLIIDIV
FT                   RFIVTQARQIIEFVGAVLDAVIAIARGGSGGVPGMIERALARSIPVLLGVLAAILGVGG
FT                   IAARVKQIVQAMSKPVDRAVDWVIDKIVGLVKKLWSKIKSAFDRKKPKPKPKPKRRPDR
FT                   KRPGRPRRRRRPDQRRRPDRRRPKRKRDPKKKRPDKRSKKDMLRALDAAVRDATRLLNA
FT                   KSATEETIRRGLPAIKARHRLSSIELEKSARNTYFITVSINPKKKTPFKTLFPYKIGKA
FT                   AASTGLTDAGVSVGALHDIGNPMREKYAAAFVINMVATPNEVKAKPRIAARYLEEAWTG
FT                   SPEKKVAWARTAVIIGVNSAERLDPKRSKSGVPAISQALGAILRPDKLRMIAFGFVWTP
FT                   EWFDINSKKTVPFSTVKNTYDGLDDTHKKAARDEEGKGIGSKRAKAVPYGLLRGHVFTS
FT                   THTKRAVTVLSKVNQQVQVLSQDPDGGVRAPKGRGVLAAYDQILRTITGDPVMIVGGYD
FT                   FDELKWEEGAQERVVQLTQLANAIDRAVRAAVARHIPEMTYPTEPNTLVKVWDKNRRNG
FT                   VFQMMQNRADEAAKDALPFGFGEGEGRSFRKWLLRLYGNAFSIVHDQSASVSSDAKLND
FT                   PGRKLAVRGPGARSKRHVAYAIMLQSQSMANAQVLANELFLANQGLGLPAKNFVQMTVF
FT                   SHVEAVVKMMVDNPDLKVGDPKIQKAIDAMEKSVREYLGEKIPPKADRKSGDQRLHDIL
FT                   VRAEAMTREIITALTAEELKSVWRKLSLLLKEAQAEAKKNAEAAKHKKAGKR"
     MNTPEAEPAP AAAASGAAPD VQARPGPSAD PKFATLKKDV QRKKRSVASS HPPPKAEAGA        60
     AQDAARPPKD DEEAQGKTAN AEKMNEAQPK DFDKDAFIKA VEKAIAEKAP KNLDEADKFA       120
     DSGKADEVRA EVHGKVGEGK ADSAEQISTT TAAPPDTSAA VPKKVVPMTP DRPPGTPGTP       180
     NPGNAVPDKL PPSATDLSAG PAQVDRQMTD AQVTETQLKK SNEPTFKNAL GEKKAAEQHS       240
     AVAPGRMRGH EKKELRAATA QAQRLGAAAM GAIGAQRVRT GQQVGAGKTG AKGRDEEKRA       300
     QVTAVLQGVF DTMKKEVEAI LDGLDKLVDD QFGREEKAAR DAFTAEHKRK MEEYKDRRYS       360
     GWTGKARWVK DLFAGLPAEA DKIFEAARDN YVRRMRQVIS DVADTIGSEL NRAKRRIAQG       420
     RTELQAAVRK LPADLRSIGQ QAAAEFSDKF DELTQSVDDK GTQLVDTLAT KYTDALKSVD       480
     DEIAAEKEKN KGLVAKAVDA VKSVINTILE LKRLLLSVLA KAASAVMLIL KDPIGFLRNL       540
     VSAVGAGLKQ FLANIGRHLQ QGIMSWLLGK TAEAGIELPS KFDAQGVLRM LASLLGLTWQ       600
     NIRARIVRKV PKMEPAVAAA ETAVPLVAEV RKRGVAGMWD DLKTRVGDLK KDLLDKVIAY       660
     VTPTIVVAGI MWVISLLNPA SAFVRAVKLI IDIVRFIVTQ ARQIIEFVGA VLDAVIAIAR       720
     GGSGGVPGMI ERALARSIPV LLGVLAAILG VGGIAARVKQ IVQAMSKPVD RAVDWVIDKI       780
     VGLVKKLWSK IKSAFDRKKP KPKPKPKRRP DRKRPGRPRR RRRPDQRRRP DRRRPKRKRD       840
     PKKKRPDKRS KKDMLRALDA AVRDATRLLN AKSATEETIR RGLPAIKARH RLSSIELEKS       900
     ARNTYFITVS INPKKKTPFK TLFPYKIGKA AASTGLTDAG VSVGALHDIG NPMREKYAAA       960
     FVINMVATPN EVKAKPRIAA RYLEEAWTGS PEKKVAWART AVIIGVNSAE RLDPKRSKSG      1020
     VPAISQALGA ILRPDKLRMI AFGFVWTPEW FDINSKKTVP FSTVKNTYDG LDDTHKKAAR      1080
     DEEGKGIGSK RAKAVPYGLL RGHVFTSTHT KRAVTVLSKV NQQVQVLSQD PDGGVRAPKG      1140
     RGVLAAYDQI LRTITGDPVM IVGGYDFDEL KWEEGAQERV VQLTQLANAI DRAVRAAVAR      1200
     HIPEMTYPTE PNTLVKVWDK NRRNGVFQMM QNRADEAAKD ALPFGFGEGE GRSFRKWLLR      1260
     LYGNAFSIVH DQSASVSSDA KLNDPGRKLA VRGPGARSKR HVAYAIMLQS QSMANAQVLA      1320
     NELFLANQGL GLPAKNFVQM TVFSHVEAVV KMMVDNPDLK VGDPKIQKAI DAMEKSVREY      1380
     LGEKIPPKAD RKSGDQRLHD ILVRAEAMTR EIITALTAEE LKSVWRKLSL LLKEAQAEAK      1440
     KNAEAAKHKK AGKR                                                        1454
//

If you have problems or comments...

PBIL Back to PBIL home page