(data stored in ACNUC7421 zone)

EMBL: CP002047.PE485

CP002047.PE485       Location/Qualifiers
FT   CDS             568720..569361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03606"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B5"
FT                   /protein_id="ADI03606.1"
FT                   /translation="MDESALRQLRAEASRADYASMARLAHALYENGLSVPEVMRECYGV
FT                   DLPTEFLVLAEADLWRLDLLLVCTHQPWWLAVPPTRGGPVAAPDPPTGTERKLLALDPD
FT                   LLPLGYTLGTNSPPWENKEVLCYRLSELAAGRPTVFRLREKSTRRDKVKRRGESLMTVL
FT                   EELHLEELRETERQMRDWDVGAEEELVGAARELVERVEELRRKVAAREAR"
     MDESALRQLR AEASRADYAS MARLAHALYE NGLSVPEVMR ECYGVDLPTE FLVLAEADLW        60
     RLDLLLVCTH QPWWLAVPPT RGGPVAAPDP PTGTERKLLA LDPDLLPLGY TLGTNSPPWE       120
     NKEVLCYRLS ELAAGRPTVF RLREKSTRRD KVKRRGESLM TVLEELHLEE LRETERQMRD       180
     WDVGAEEELV GAARELVERV EELRRKVAAR EAR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page