(data stored in ACNUC7421 zone)

EMBL: CP002047.PE488

CP002047.PE488       Location/Qualifiers
FT   CDS             complement(571857..573719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03609"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B8"
FT                   /protein_id="ADI03609.1"
FT                   /translation="MSAPTAPTVPSAGPSAGETGDITVHRCTVTVVRRGGWSWGPDPRG
FT                   LVRQVVDALPELLADHFAERLAGDGPDVEITEPLTVTVRPGRPGGPGRPAGGGPAVEVH
FT                   FAPVPVVELPADASGADAMSLEESFAAAPDPWTVPSAAVLFAELAERGELDALLALLPD
FT                   ESVRAYLRAVLGVDDTAAPAARLLAELVGRALAAAPPPADPHGLAAARSRPVEALPQRL
FT                   RAAVAGAEAADLPRLLADYLASADREETVRLARSLGPGGPYDHTADQPPGETRTTDEVR
FT                   TANPVRTTGEVRVWSALPFLLAGPLARIGYLDAIGPALAGVELADQAPLFAAALGYKVL
FT                   GVTARGWRRADRDSEAAAAFAGLQPPVAEERLAAFARQVRPALPVLDGVLALSVCRGHD
FT                   PAHPLLITGTDHGLFLVDAHGMFPIAWAAQAAGLLPYWQACGHPPVLLCDGPLPPGTLR
FT                   ELAAAGVLFLTGVRPLRGDPVARLPWRTPLWTAEGTAPDVRLAAELPAHAQRFADLAAA
FT                   LVGERRAVPLAPDGGLERTVTLAATLGLATIAWTLWRDRETPDPLSALSRFADLEATVR
FT                   YEPAAVRVRVPMGRRHADLLRGGLLADVPDVVWLNGRTLTFSAG"
     MSAPTAPTVP SAGPSAGETG DITVHRCTVT VVRRGGWSWG PDPRGLVRQV VDALPELLAD        60
     HFAERLAGDG PDVEITEPLT VTVRPGRPGG PGRPAGGGPA VEVHFAPVPV VELPADASGA       120
     DAMSLEESFA AAPDPWTVPS AAVLFAELAE RGELDALLAL LPDESVRAYL RAVLGVDDTA       180
     APAARLLAEL VGRALAAAPP PADPHGLAAA RSRPVEALPQ RLRAAVAGAE AADLPRLLAD       240
     YLASADREET VRLARSLGPG GPYDHTADQP PGETRTTDEV RTANPVRTTG EVRVWSALPF       300
     LLAGPLARIG YLDAIGPALA GVELADQAPL FAAALGYKVL GVTARGWRRA DRDSEAAAAF       360
     AGLQPPVAEE RLAAFARQVR PALPVLDGVL ALSVCRGHDP AHPLLITGTD HGLFLVDAHG       420
     MFPIAWAAQA AGLLPYWQAC GHPPVLLCDG PLPPGTLREL AAAGVLFLTG VRPLRGDPVA       480
     RLPWRTPLWT AEGTAPDVRL AAELPAHAQR FADLAAALVG ERRAVPLAPD GGLERTVTLA       540
     ATLGLATIAW TLWRDRETPD PLSALSRFAD LEATVRYEPA AVRVRVPMGR RHADLLRGGL       600
     LADVPDVVWL NGRTLTFSAG                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page