(data stored in ACNUC7421 zone)

EMBL: CP002047.PE489

CP002047.PE489       Location/Qualifiers
FT   CDS             complement(573716..574246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03610"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0B9"
FT                   /protein_id="ADI03610.1"
FT                   /translation="MALSVVYAVDTGHVVGALALTGAGAPPDVAALVGRALPLRVSLGT
FT                   GRIATLPLSARDLAVASVDDEPAALAVPLDFGVEVTSDGKPKPALVRLASWTDGIALTE
FT                   DGLTVTVKVAVARPTPVLALVSDEQDTHVLAGEIPAQQTQAKLPVTLVKGSVHGVLVLA
FT                   TGWAGHLEKAAVT"
     MALSVVYAVD TGHVVGALAL TGAGAPPDVA ALVGRALPLR VSLGTGRIAT LPLSARDLAV        60
     ASVDDEPAAL AVPLDFGVEV TSDGKPKPAL VRLASWTDGI ALTEDGLTVT VKVAVARPTP       120
     VLALVSDEQD THVLAGEIPA QQTQAKLPVT LVKGSVHGVL VLATGWAGHL EKAAVT           176
//

If you have problems or comments...

PBIL Back to PBIL home page