(data stored in ACNUC7421 zone)

EMBL: CP002047.PE49

CP002047.PE49        Location/Qualifiers
FT   CDS             44207..45625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00049"
FT                   /product="putative serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03170"
FT                   /db_xref="GOA:D7BUH9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUH9"
FT                   /protein_id="ADI03170.1"
FT                   /translation="MGSLGADDPAEVGAYRLLGVLGHGGMGRVYLGRSQGGRLVAVKVV
FT                   HRHLAADERFRARFASEVAAARLVSGEQNHNRTAPVLTADPEAEVPWVATGYVAGSDLA
FT                   HMVEEHGPLPERTVRALGIGLAEALGAVHAQGLVHRDVKPSNVLLALDGPHLIDFGIAR
FT                   AAEAATRLTSTGVAVGSPGFMAPEQVTGEAAVGPATDVFSLGTVLAYAASGQQPFPGES
FT                   AAQLLYRVAHAEPRLDGVAPDAVKELVSACLAKDPAARPTLPEVVRALAGEQDAGASLD
FT                   SSRWLPTAVADDIGRRAVELLQLESGPADPGLPARPHSPTLVDSAPASGPNAATVTVTA
FT                   QPKPETTAKPELANKPEPPDAQAKKQGPWLAVGASALLAVLIFGVWNAFQDDDKTAALP
FT                   NSFVGHWSDSANGYGNQLELNAGRVGEEVGRLTADVDACRRSSRRVWALLPAARMRRPA
FT                   RWSRRRSPFWMPHR"
     MGSLGADDPA EVGAYRLLGV LGHGGMGRVY LGRSQGGRLV AVKVVHRHLA ADERFRARFA        60
     SEVAAARLVS GEQNHNRTAP VLTADPEAEV PWVATGYVAG SDLAHMVEEH GPLPERTVRA       120
     LGIGLAEALG AVHAQGLVHR DVKPSNVLLA LDGPHLIDFG IARAAEAATR LTSTGVAVGS       180
     PGFMAPEQVT GEAAVGPATD VFSLGTVLAY AASGQQPFPG ESAAQLLYRV AHAEPRLDGV       240
     APDAVKELVS ACLAKDPAAR PTLPEVVRAL AGEQDAGASL DSSRWLPTAV ADDIGRRAVE       300
     LLQLESGPAD PGLPARPHSP TLVDSAPASG PNAATVTVTA QPKPETTAKP ELANKPEPPD       360
     AQAKKQGPWL AVGASALLAV LIFGVWNAFQ DDDKTAALPN SFVGHWSDSA NGYGNQLELN       420
     AGRVGEEVGR LTADVDACRR SSRRVWALLP AARMRRPARW SRRRSPFWMP HR               472
//

If you have problems or comments...

PBIL Back to PBIL home page