(data stored in ACNUC7421 zone)

EMBL: CP002047.PE490

CP002047.PE490       Location/Qualifiers
FT   CDS             complement(574249..575385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03611"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C0"
FT                   /protein_id="ADI03611.1"
FT                   /translation="MTGPLRPAFHEGQVLAAADLTAAVEHARGQSARHARHLHEWGIVE
FT                   GLGLATEARTDPLTGVRHVEVSVAAGIALDGTGREVVVTEPAVLRESDFEEVNGADQPT
FT                   DEPYPVFLTAADREPAQRPGPVSCSGSATKTRVEESYQILFGRLGDERLVEEQQPPAIG
FT                   DPPADPPVRWLILLGYVRWTDGHFSGVETTARGVVVRFAGVRADTVVARSGALTLRTAP
FT                   AAQEGKPALVLSGGDQPSLVFGLYQGGGAVAPLMTVAANGNLAIAGSFSGRMPAGSTLV
FT                   ASGTATDGMLLPLPSGVTPEQVADGRVVIHVQLTPRTPPLADTALYSPVEATVDGDRRV
FT                   RCRMRLYDPLVTPAKVVEQPGAVDFLVLATVAATNGGG"
     MTGPLRPAFH EGQVLAAADL TAAVEHARGQ SARHARHLHE WGIVEGLGLA TEARTDPLTG        60
     VRHVEVSVAA GIALDGTGRE VVVTEPAVLR ESDFEEVNGA DQPTDEPYPV FLTAADREPA       120
     QRPGPVSCSG SATKTRVEES YQILFGRLGD ERLVEEQQPP AIGDPPADPP VRWLILLGYV       180
     RWTDGHFSGV ETTARGVVVR FAGVRADTVV ARSGALTLRT APAAQEGKPA LVLSGGDQPS       240
     LVFGLYQGGG AVAPLMTVAA NGNLAIAGSF SGRMPAGSTL VASGTATDGM LLPLPSGVTP       300
     EQVADGRVVI HVQLTPRTPP LADTALYSPV EATVDGDRRV RCRMRLYDPL VTPAKVVEQP       360
     GAVDFLVLAT VAATNGGG                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page