(data stored in ACNUC7421 zone)

EMBL: CP002047.PE492

CP002047.PE492       Location/Qualifiers
FT   CDS             complement(577400..580630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00492"
FT                   /product="NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03613"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="InterPro:IPR011748"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C2"
FT                   /protein_id="ADI03613.1"
FT                   /translation="MTCAPHPATFRLLDTYVGWDESTEPGARGIVGIVGFDDPAGLRLA
FT                   YRGDAPEGPTRGSLLPWFPDPRLAPGCGPCAWYLLVPDERRLLRRDVCSGAFTPVWPPG
FT                   CDPAALREPVSVAARGHRLAVVESDRVLVWRREGGQLAGVIRAERPRWAALAPDDEVLV
FT                   ACQGSTNLRRYDSTGGFRGVLRTGARGEVIGLRTGPERTVWLLTDDDGRIRIHRGGHRG
FT                   PFRPVTVDELAAALPPSALTSAGEDGFCLSEKGPDGPQTTCFTWQGQPRDAAPPATDAY
FT                   MTSGSYVTTLIDSGISRCRWHRVRVDADVPAGTAVAVDIVVSEDGRYEESDWQLSAPGA
FT                   TDFLVDQPPGRFLRLRLRLSGDGGATPVVRRIRLDFPRATSADLLPPAFRQDPAADDFT
FT                   ERFLSLFDATLAQLDRVIERYPALLDPAGVPDRVLPWLAGLLGLSYEAGWDAPTRRALL
FT                   AAAPELYRRRGTPWALREAVRIVFGAAPVIDELAADRRRAQGAAAQSRTGTGAGAGATK
FT                   GPGAGRGAAVRPVGEPVPDRRLGAGRGAAARLRRTGQRSVHRARTPVPGASARRIGGPD
FT                   GAAAAGGAAGARAHGGVGADRRRGVRGRFAVHGRRGHRVRPAARARTGRRAARAAEPRR
FT                   GAQAGTGRVAARGGRRSRLRRRCAYASVVRGRAMTETETSRTEEFDAPPLRRLRYFHGQ
FT                   MLGARDFQREQEYHREKLRLRMRCLLGYGVVCGLHVEPAPRDEDDCPPDAEAPAEGEAD
FT                   RTEHTRRRAKVKLTPGLAVDCDGNEVVVRGGCVIDLWKALPPDERDTDTVWVGIEYAER
FT                   PVEPTRAVYNDACADTSDCEFGWTEECHKVRVTGCEPPVDERCDTCCSPCEHKVLWLAR
FT                   IDCVDWYEPVRRDQIHMNVRRPFGRHLPTVITGINWIHGHTYTIDEAKALLGTQDQDGG
FT                   LVVRFSADVRSDTLRPGVVELQVIEGGSGRNASTWYMGGAFAEPDAESDGCDEFTEGFR
FT                   YRQTTRETLQDGDRLLITVRAAFILDRCCRPVDGTHVGGRVPTIDAEATPAAAHGGCHL
FT                   PPSGIGPWTSGTGAGGDVFESWFFVKER"
     MTCAPHPATF RLLDTYVGWD ESTEPGARGI VGIVGFDDPA GLRLAYRGDA PEGPTRGSLL        60
     PWFPDPRLAP GCGPCAWYLL VPDERRLLRR DVCSGAFTPV WPPGCDPAAL REPVSVAARG       120
     HRLAVVESDR VLVWRREGGQ LAGVIRAERP RWAALAPDDE VLVACQGSTN LRRYDSTGGF       180
     RGVLRTGARG EVIGLRTGPE RTVWLLTDDD GRIRIHRGGH RGPFRPVTVD ELAAALPPSA       240
     LTSAGEDGFC LSEKGPDGPQ TTCFTWQGQP RDAAPPATDA YMTSGSYVTT LIDSGISRCR       300
     WHRVRVDADV PAGTAVAVDI VVSEDGRYEE SDWQLSAPGA TDFLVDQPPG RFLRLRLRLS       360
     GDGGATPVVR RIRLDFPRAT SADLLPPAFR QDPAADDFTE RFLSLFDATL AQLDRVIERY       420
     PALLDPAGVP DRVLPWLAGL LGLSYEAGWD APTRRALLAA APELYRRRGT PWALREAVRI       480
     VFGAAPVIDE LAADRRRAQG AAAQSRTGTG AGAGATKGPG AGRGAAVRPV GEPVPDRRLG       540
     AGRGAAARLR RTGQRSVHRA RTPVPGASAR RIGGPDGAAA AGGAAGARAH GGVGADRRRG       600
     VRGRFAVHGR RGHRVRPAAR ARTGRRAARA AEPRRGAQAG TGRVAARGGR RSRLRRRCAY       660
     ASVVRGRAMT ETETSRTEEF DAPPLRRLRY FHGQMLGARD FQREQEYHRE KLRLRMRCLL       720
     GYGVVCGLHV EPAPRDEDDC PPDAEAPAEG EADRTEHTRR RAKVKLTPGL AVDCDGNEVV       780
     VRGGCVIDLW KALPPDERDT DTVWVGIEYA ERPVEPTRAV YNDACADTSD CEFGWTEECH       840
     KVRVTGCEPP VDERCDTCCS PCEHKVLWLA RIDCVDWYEP VRRDQIHMNV RRPFGRHLPT       900
     VITGINWIHG HTYTIDEAKA LLGTQDQDGG LVVRFSADVR SDTLRPGVVE LQVIEGGSGR       960
     NASTWYMGGA FAEPDAESDG CDEFTEGFRY RQTTRETLQD GDRLLITVRA AFILDRCCRP      1020
     VDGTHVGGRV PTIDAEATPA AAHGGCHLPP SGIGPWTSGT GAGGDVFESW FFVKER          1076
//

If you have problems or comments...

PBIL Back to PBIL home page