(data stored in ACNUC7421 zone)

EMBL: CP002047.PE493

CP002047.PE493       Location/Qualifiers
FT   CDS             complement(580627..582687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03614"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C3"
FT                   /protein_id="ADI03614.1"
FT                   /translation="MTGDVWWERDAREQERADGRIVPGPGPTGGGPELVDATREAVRAE
FT                   VRGRIAGYTPDWTDPDRQDAGVALVRLFGTQAEPVLGRVNRLPEKALAEHLAIAGVRRR
FT                   PAGAAAALLEFTVNPPNGSSVLVPAGFQSAAQTPAGQVVYETDQDLYATPATLGDLAVQ
FT                   EAGTLEPLPLGPSGPSRPFAPFGRDPEPGNGLWIGLAGPAGPYPRLSLGIVVVAAPPAP
FT                   TASGGALPLPLPPAPLLRWDVLDGTRLVPAELIRDSTAGLSASGTVELRVPRSWEPGTP
FT                   AATRPRLRWLRVRIAHGAFTGPAPVLSGLRLNVVAATAARTIRDEPLQPVQDPAATGRR
FT                   RMKLSQVPILAGSVVIEVDDDAGGDVFGTSAATTAGTSSRWREVESLAGYGADDRVFTV
FT                   DYDSGEVTFGDGVNGAAVPPGFRNVRAVRYRVGGGSAGAVRAGAVGAVVTALPFVTGVG
FT                   NPFPASGGTDAEPDADAMRRGVGELRARGRAVAPADYGLLATRAPGASVARARGVPGLH
FT                   PDFAGAPIPGVVGVLVVPPVLPDDPGEPPVPTAATLRAVADFLSREAAPAGVTVVAAPA
FT                   PYHRVAVESWVTLDPDLDRAAVLARAGDAVRTYLDPLRGGEDGAGWPFGGALRHTALVR
FT                   RLLAVDGVLAVTRLSLTVDGVRRPPCTDHALPPHTLVWPERPLLIPVGDPS"
     MTGDVWWERD AREQERADGR IVPGPGPTGG GPELVDATRE AVRAEVRGRI AGYTPDWTDP        60
     DRQDAGVALV RLFGTQAEPV LGRVNRLPEK ALAEHLAIAG VRRRPAGAAA ALLEFTVNPP       120
     NGSSVLVPAG FQSAAQTPAG QVVYETDQDL YATPATLGDL AVQEAGTLEP LPLGPSGPSR       180
     PFAPFGRDPE PGNGLWIGLA GPAGPYPRLS LGIVVVAAPP APTASGGALP LPLPPAPLLR       240
     WDVLDGTRLV PAELIRDSTA GLSASGTVEL RVPRSWEPGT PAATRPRLRW LRVRIAHGAF       300
     TGPAPVLSGL RLNVVAATAA RTIRDEPLQP VQDPAATGRR RMKLSQVPIL AGSVVIEVDD       360
     DAGGDVFGTS AATTAGTSSR WREVESLAGY GADDRVFTVD YDSGEVTFGD GVNGAAVPPG       420
     FRNVRAVRYR VGGGSAGAVR AGAVGAVVTA LPFVTGVGNP FPASGGTDAE PDADAMRRGV       480
     GELRARGRAV APADYGLLAT RAPGASVARA RGVPGLHPDF AGAPIPGVVG VLVVPPVLPD       540
     DPGEPPVPTA ATLRAVADFL SREAAPAGVT VVAAPAPYHR VAVESWVTLD PDLDRAAVLA       600
     RAGDAVRTYL DPLRGGEDGA GWPFGGALRH TALVRRLLAV DGVLAVTRLS LTVDGVRRPP       660
     CTDHALPPHT LVWPERPLLI PVGDPS                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page