(data stored in ACNUC7421 zone)

EMBL: CP002047.PE494

CP002047.PE494       Location/Qualifiers
FT   CDS             complement(582684..584297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03615"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR011749"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C4"
FT                   /protein_id="ADI03615.1"
FT                   /translation="MSSPSRTTWPSSRSPRTARSPCGPIATVRRTCGPPRRGVALLAGD
FT                   GAPAQVRFTLPLTGAHPAPGPICLLVELDAPAASAPSWLPGAVADVPPPAELTWSWFRP
FT                   GTDVSGAFEKVEDGTAGLRRSGVVRLHPPAGWTTRDTGLLVSTPAATYAAPPRLLQLAV
FT                   NVSAAHHLRRRTARGSDLQEQIDAWLKLPGQHLVLPDAADRLLEATVQLAGQQWQPVPD
FT                   FTFGAPADRIFVLDRTEGAVVFGDGLTGRIPRPGPDAQIEYATGGGRGGNGGMTGNWLA
FT                   APDLPAPPGAVSAANLVRAEGGTDPETVTEARRRAAASLGEVTRAVTAADYVTLARTTP
FT                   GVAVARAYPSLGEHPGFPCATVPGAVSVHIVPAAPRDDLDREDFVAAPLPDPGMVCAVA
FT                   ARLAQARLLTSEVIVRPPRYREVTLRVDLSGDPADRSRVSTVVTAALRRFLDPLVGGED
FT                   QDGWPFGQPLRPSALLRAAQRALGDLGDIAAVAIGLDGVDSDGAFEACDEVPLGAGALP
FT                   VLRTVRTRIVPAVEPGEGLV"
     MSSPSRTTWP SSRSPRTARS PCGPIATVRR TCGPPRRGVA LLAGDGAPAQ VRFTLPLTGA        60
     HPAPGPICLL VELDAPAASA PSWLPGAVAD VPPPAELTWS WFRPGTDVSG AFEKVEDGTA       120
     GLRRSGVVRL HPPAGWTTRD TGLLVSTPAA TYAAPPRLLQ LAVNVSAAHH LRRRTARGSD       180
     LQEQIDAWLK LPGQHLVLPD AADRLLEATV QLAGQQWQPV PDFTFGAPAD RIFVLDRTEG       240
     AVVFGDGLTG RIPRPGPDAQ IEYATGGGRG GNGGMTGNWL AAPDLPAPPG AVSAANLVRA       300
     EGGTDPETVT EARRRAAASL GEVTRAVTAA DYVTLARTTP GVAVARAYPS LGEHPGFPCA       360
     TVPGAVSVHI VPAAPRDDLD REDFVAAPLP DPGMVCAVAA RLAQARLLTS EVIVRPPRYR       420
     EVTLRVDLSG DPADRSRVST VVTAALRRFL DPLVGGEDQD GWPFGQPLRP SALLRAAQRA       480
     LGDLGDIAAV AIGLDGVDSD GAFEACDEVP LGAGALPVLR TVRTRIVPAV EPGEGLV          537
//

If you have problems or comments...

PBIL Back to PBIL home page