(data stored in ACNUC7421 zone)

EMBL: CP002047.PE496

CP002047.PE496       Location/Qualifiers
FT   CDS             complement(584643..585065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00496"
FT                   /product="tail lysozyme, putative"
FT                   /note="COG3628 Phage baseplate assembly protein W"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03617"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C6"
FT                   /protein_id="ADI03617.1"
FT                   /translation="MSEEFLGTGWRFPILPDASGRLGYAVGEESIEHCLRALLLTGVGE
FT                   RVMRPDLGTRAHELVFAPGSVQNLRDLEQSIATAVRDHEPRVELEEVRAEADPADESRI
FT                   TVSVVYRIRRSNTKANLVFPFYTGLTGLTGLTGGTS"
     MSEEFLGTGW RFPILPDASG RLGYAVGEES IEHCLRALLL TGVGERVMRP DLGTRAHELV        60
     FAPGSVQNLR DLEQSIATAV RDHEPRVELE EVRAEADPAD ESRITVSVVY RIRRSNTKAN       120
     LVFPFYTGLT GLTGLTGGTS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page