(data stored in ACNUC7421 zone)

EMBL: CP002047.PE497

CP002047.PE497       Location/Qualifiers
FT   CDS             complement(585062..585763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00497"
FT                   /product="hypothetical protein"
FT                   /note="COG3501 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03618"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C7"
FT                   /protein_id="ADI03618.1"
FT                   /translation="MTMRGTPRARSTDKRYYGVVEALVVENEGDDEGQVKLKFPWFDDT
FT                   TVTDWVRVSQLYAGGGYGSVFVPEKGDEVLVAFVHGDMRYPIVLGGLYNGEDKPPTART
FT                   EGRDQKLIRTRHGHEVLLDDTQSKAAVKITSAAGHVVELDDQGKAIRITAAEGGSVTVT
FT                   AQGEITLKAPKVTLDSPSIDLGGGATEPLVLGNALLQAFNAHTHPSAAGPTGPPTPPLT
FT                   PAVLAKKARTA"
     MTMRGTPRAR STDKRYYGVV EALVVENEGD DEGQVKLKFP WFDDTTVTDW VRVSQLYAGG        60
     GYGSVFVPEK GDEVLVAFVH GDMRYPIVLG GLYNGEDKPP TARTEGRDQK LIRTRHGHEV       120
     LLDDTQSKAA VKITSAAGHV VELDDQGKAI RITAAEGGSV TVTAQGEITL KAPKVTLDSP       180
     SIDLGGGATE PLVLGNALLQ AFNAHTHPSA AGPTGPPTPP LTPAVLAKKA RTA              233
//

If you have problems or comments...

PBIL Back to PBIL home page