(data stored in ACNUC7421 zone)

EMBL: CP002047.PE498

CP002047.PE498       Location/Qualifiers
FT   CDS             complement(585760..586941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00498"
FT                   /product="hypothetical protein"
FT                   /note="COG3500 Phage protein D"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03619"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C8"
FT                   /protein_id="ADI03619.1"
FT                   /translation="MSTPTPEVASPDRYAPEFDVRIEGLEMDPSTKNDIIDIKVNRDID
FT                   EMSGFDLTLNNWDDVGLRFKHSDSPSFRLGGRVSVRLGYADRLLTVATGTISTLSPKFT
FT                   DAASPTVQVSGVDGLLRLKDRKPTENETKIYRNLPDWRIAEQIAQRNHLRIEVTREGPT
FT                   HDLVVQKNQDDATFLLERAKRLDFDCYILPDPKDGEDTLYFIKPTDGRDGRPIRVYRLA
FT                   YAPGLSTGPTDQPEGLVPNLMEFTPTLTVSQQVSKVTVRGWDPRTKAAIAFTATAENLP
FT                   AGQNTADGQSGPQVAESTLQGRQEVVVDAPVGSDQEARELAISLLRERAYEFITATGKV
FT                   AGLPELRPGDNLEIYGLGRRFSGTYFVKRVEHTLNTSGFFTQFTARRIHQGGR"
     MSTPTPEVAS PDRYAPEFDV RIEGLEMDPS TKNDIIDIKV NRDIDEMSGF DLTLNNWDDV        60
     GLRFKHSDSP SFRLGGRVSV RLGYADRLLT VATGTISTLS PKFTDAASPT VQVSGVDGLL       120
     RLKDRKPTEN ETKIYRNLPD WRIAEQIAQR NHLRIEVTRE GPTHDLVVQK NQDDATFLLE       180
     RAKRLDFDCY ILPDPKDGED TLYFIKPTDG RDGRPIRVYR LAYAPGLSTG PTDQPEGLVP       240
     NLMEFTPTLT VSQQVSKVTV RGWDPRTKAA IAFTATAENL PAGQNTADGQ SGPQVAESTL       300
     QGRQEVVVDA PVGSDQEARE LAISLLRERA YEFITATGKV AGLPELRPGD NLEIYGLGRR       360
     FSGTYFVKRV EHTLNTSGFF TQFTARRIHQ GGR                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page