(data stored in ACNUC7421 zone)

EMBL: CP002047.PE499

CP002047.PE499       Location/Qualifiers
FT   CDS             complement(586952..587623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00499"
FT                   /product="hypothetical protein"
FT                   /note="COG1652 Uncharacterized protein containing LysM
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03620"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0C9"
FT                   /protein_id="ADI03620.1"
FT                   /translation="MSVTPVSFARQGSARARLEIVRPVIADERQRRIPLRFNPTDYKLS
FT                   KSNTFAEITIPGLETPPLQYVRGGTETLTVQALVDTSDTLENVRKAYVNAVRNLLRPDS
FT                   REHAPPVVRFVWDEEVFTGVVEKLDVNYQLFRPDGVPLRAMLDLSLKEFRPAATQIAET
FT                   PRSSPTVEKSYVVRRGDTLSSISAALYRRPDAWRELARANGISDPRELRPGRVLTVPRL
FT                   A"
     MSVTPVSFAR QGSARARLEI VRPVIADERQ RRIPLRFNPT DYKLSKSNTF AEITIPGLET        60
     PPLQYVRGGT ETLTVQALVD TSDTLENVRK AYVNAVRNLL RPDSREHAPP VVRFVWDEEV       120
     FTGVVEKLDV NYQLFRPDGV PLRAMLDLSL KEFRPAATQI AETPRSSPTV EKSYVVRRGD       180
     TLSSISAALY RRPDAWRELA RANGISDPRE LRPGRVLTVP RLA                         223
//

If you have problems or comments...

PBIL Back to PBIL home page