(data stored in ACNUC7421 zone)

EMBL: CP002047.PE50

CP002047.PE50        Location/Qualifiers
FT   CDS             45989..47506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03171"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI0"
FT                   /protein_id="ADI03171.1"
FT                   /translation="MHHILCGLAANPALSSELVDRLISIADDDIAAGLACRADLSRAQA
FT                   VALAERVDESAVRLAYEGRLTAADIDPAVWPDAALALLDQGVGRPEWARRLAADPVRER
FT                   REQLAACRGLPSDVVDTLAADPDVRVVAELALWTTPDVAARLAAHPHAEVRRAVASNEA
FT                   TPPAALVALVTGEGLPAARHCLVCDREETPFIHDPQCLRPDCDLLPGASCDGSHESTVH
FT                   AMREAALRNPATPVEAVVGFVDYPSMQLRWALAARQDLPQQACARLASDPTPGVRADVA
FT                   ENPAIDDALIRALAGDRDPDVRRRLAHHPRVPLDVLTHLARTTKIGATLLPRIAASSPT
FT                   EVEELATSPDPATRMLVAQRRDLPPEIRDRLADDPDAKVVKALAPHPGLTEAQLRTMVD
FT                   RHGVRVLAKVAANPDAPPALLEDLLRHEPAAQKVFREVARHRGATASALLACLTDKRAR
FT                   PVAAGHPALPPPVIAELLADTDWQVAEAAAANPSLPLAVISDLVGRQ"
     MHHILCGLAA NPALSSELVD RLISIADDDI AAGLACRADL SRAQAVALAE RVDESAVRLA        60
     YEGRLTAADI DPAVWPDAAL ALLDQGVGRP EWARRLAADP VRERREQLAA CRGLPSDVVD       120
     TLAADPDVRV VAELALWTTP DVAARLAAHP HAEVRRAVAS NEATPPAALV ALVTGEGLPA       180
     ARHCLVCDRE ETPFIHDPQC LRPDCDLLPG ASCDGSHEST VHAMREAALR NPATPVEAVV       240
     GFVDYPSMQL RWALAARQDL PQQACARLAS DPTPGVRADV AENPAIDDAL IRALAGDRDP       300
     DVRRRLAHHP RVPLDVLTHL ARTTKIGATL LPRIAASSPT EVEELATSPD PATRMLVAQR       360
     RDLPPEIRDR LADDPDAKVV KALAPHPGLT EAQLRTMVDR HGVRVLAKVA ANPDAPPALL       420
     EDLLRHEPAA QKVFREVARH RGATASALLA CLTDKRARPV AAGHPALPPP VIAELLADTD       480
     WQVAEAAAAN PSLPLAVISD LVGRQ                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page