(data stored in ACNUC7421 zone)

EMBL: CP002047.PE502

CP002047.PE502       Location/Qualifiers
FT   CDS             complement(588323..589816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00502"
FT                   /product="putative phage tail sheath protein"
FT                   /note="COG3497 Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03623"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D2"
FT                   /protein_id="ADI03623.1"
FT                   /translation="MVGEALPGVSLTYRPRGSDTEPLRTDVAAFLGRLRRGPVATPVRV
FT                   ESWNDVVGAFGPPDGAFATPYALRGFFENGGRTAWVLRVSGPATTARTRWPAGPLGGLA
FT                   ATDFQVVATSPGAWANGGRVAIRYQASTVAGPAGVGVRITMPGEAPETFAGLPLADVAD
FT                   RLTASRYIRLIPDGPPPPPGRPGPISMSWDLTLTGGAESPPTRGEYADAVTLQAELPEP
FT                   ALVALPDLGADLSGSAHTELVLELLRSVAPLHDRLAVLDVPPRLSSVDEAVDWAGSLAA
FT                   GGDSALLGCAAVYHPPLRTPDGQALRTVPASGHVLGVIARLDAERGAHHTPAGAVILEA
FT                   VDLAAEYPEPQQVRLFDAGLDLIRCTRGRGLMVWGGRTLSADPGTRYIAHRRLVHLLVR
FT                   AIRRVASPLVFDVNSPELRLTLVRALTSVLLSAFRAGALAGDRPEQAFRVVCDDTNNPP
FT                   EQDPGQLVCEIEVAPAVPMEFIRLRLVLGQDRGLEVIEA"
     MVGEALPGVS LTYRPRGSDT EPLRTDVAAF LGRLRRGPVA TPVRVESWND VVGAFGPPDG        60
     AFATPYALRG FFENGGRTAW VLRVSGPATT ARTRWPAGPL GGLAATDFQV VATSPGAWAN       120
     GGRVAIRYQA STVAGPAGVG VRITMPGEAP ETFAGLPLAD VADRLTASRY IRLIPDGPPP       180
     PPGRPGPISM SWDLTLTGGA ESPPTRGEYA DAVTLQAELP EPALVALPDL GADLSGSAHT       240
     ELVLELLRSV APLHDRLAVL DVPPRLSSVD EAVDWAGSLA AGGDSALLGC AAVYHPPLRT       300
     PDGQALRTVP ASGHVLGVIA RLDAERGAHH TPAGAVILEA VDLAAEYPEP QQVRLFDAGL       360
     DLIRCTRGRG LMVWGGRTLS ADPGTRYIAH RRLVHLLVRA IRRVASPLVF DVNSPELRLT       420
     LVRALTSVLL SAFRAGALAG DRPEQAFRVV CDDTNNPPEQ DPGQLVCEIE VAPAVPMEFI       480
     RLRLVLGQDR GLEVIEA                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page