(data stored in ACNUC7421 zone)

EMBL: CP002047.PE503

CP002047.PE503       Location/Qualifiers
FT   CDS             complement(589818..590273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00503"
FT                   /product="hypothetical protein"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03624"
FT                   /db_xref="GOA:D7C0D3"
FT                   /db_xref="InterPro:IPR010667"
FT                   /db_xref="InterPro:IPR011747"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D3"
FT                   /protein_id="ADI03624.1"
FT                   /translation="MPPVTRDDPYASYNFQIIVTNVSDDGVAVSGSFTEVSGLELEVPP
FT                   IEYRTGSEDITVRKIPGLKKFTNLTFKRGITGHVGFWNWVVEALNGKVRRTSGSIVLLD
FT                   ENRQETMRWNFDRGWPTKYTGPTLSATKNEIAMETLVLAVEKLEIDV"
     MPPVTRDDPY ASYNFQIIVT NVSDDGVAVS GSFTEVSGLE LEVPPIEYRT GSEDITVRKI        60
     PGLKKFTNLT FKRGITGHVG FWNWVVEALN GKVRRTSGSI VLLDENRQET MRWNFDRGWP       120
     TKYTGPTLSA TKNEIAMETL VLAVEKLEID V                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page