(data stored in ACNUC7421 zone)

EMBL: CP002047.PE504

CP002047.PE504       Location/Qualifiers
FT   CDS             complement(590294..592558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00504"
FT                   /product="hypothetical protein"
FT                   /note="COG3497 Phage tail sheath protein FI"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03625"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D4"
FT                   /protein_id="ADI03625.1"
FT                   /translation="MAEYLSPGVYIEEIDAGPRPIAGVSTSTAGMAGVTVRGPYTGKPK
FT                   LVTNFLEFQNTFGGFLPEPDALIRDTWANDPKEGGRWWLFPLAVKGFFDNGGQRLYVKR
FT                   VASRQATPASGVLGHGLVSPVARDAAKGATRLELGHLIGFSGVGQQIQLFRGDDQQVIH
FT                   TAGVAAYDATAHRVELDAALTAEVRTGRGDYVQIGARSAEETLEFSAVSPGSWGGAVQV
FT                   RIQPMASAALPVLPDPQEGALFVTQLAADAAADSATVEVAAVAGLDPDDLPPEVWAQIG
FT                   SGRFKVEVGQPADGKVTLTLPSGTAHEAWRRGLVVRRVRRGNTSAGPTLRVGGASRLYE
FT                   GAVVQLDDGTTLTIRTVEAIAADLVTFDADVPGTLFETDRLRLVEAQVDARFTDPSGAV
FT                   VTESYPNLRLTGDAPTNLVTTLAGRSQLVRAVALGALSTDPAKFPVPAVGSWLTLADGD
FT                   DAYGSLSVADFVGEDGGSGKRTGIAALEDIDEVAVCAVPGVWSGTAESALVTHCELLRD
FT                   RFAILDPQDGLDIEGVQAFREPFDTKYAALYHPWLVTRDPATGRDVEVPPSGHMAGIYA
FT                   RVDVERGVHKAPANAVIRGIRLTDGIAQDITKRHQDLLNPKGINALRFFPGMGHRVWGA
FT                   RTLSSDSSWKYINVRRLFLYLEESIDEGTQWVVFEPNDEALWALVRQTVTNFLTTVWRS
FT                   GALAGTTPDEAFFVACDRTTMTEDDLANGRLICVIGVAPVFPAEFVIFRIQQKTRETQL
FT                   A"
     MAEYLSPGVY IEEIDAGPRP IAGVSTSTAG MAGVTVRGPY TGKPKLVTNF LEFQNTFGGF        60
     LPEPDALIRD TWANDPKEGG RWWLFPLAVK GFFDNGGQRL YVKRVASRQA TPASGVLGHG       120
     LVSPVARDAA KGATRLELGH LIGFSGVGQQ IQLFRGDDQQ VIHTAGVAAY DATAHRVELD       180
     AALTAEVRTG RGDYVQIGAR SAEETLEFSA VSPGSWGGAV QVRIQPMASA ALPVLPDPQE       240
     GALFVTQLAA DAAADSATVE VAAVAGLDPD DLPPEVWAQI GSGRFKVEVG QPADGKVTLT       300
     LPSGTAHEAW RRGLVVRRVR RGNTSAGPTL RVGGASRLYE GAVVQLDDGT TLTIRTVEAI       360
     AADLVTFDAD VPGTLFETDR LRLVEAQVDA RFTDPSGAVV TESYPNLRLT GDAPTNLVTT       420
     LAGRSQLVRA VALGALSTDP AKFPVPAVGS WLTLADGDDA YGSLSVADFV GEDGGSGKRT       480
     GIAALEDIDE VAVCAVPGVW SGTAESALVT HCELLRDRFA ILDPQDGLDI EGVQAFREPF       540
     DTKYAALYHP WLVTRDPATG RDVEVPPSGH MAGIYARVDV ERGVHKAPAN AVIRGIRLTD       600
     GIAQDITKRH QDLLNPKGIN ALRFFPGMGH RVWGARTLSS DSSWKYINVR RLFLYLEESI       660
     DEGTQWVVFE PNDEALWALV RQTVTNFLTT VWRSGALAGT TPDEAFFVAC DRTTMTEDDL       720
     ANGRLICVIG VAPVFPAEFV IFRIQQKTRE TQLA                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page