(data stored in ACNUC7421 zone)

EMBL: CP002047.PE505

CP002047.PE505       Location/Qualifiers
FT   CDS             complement(592569..593297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03626"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D5"
FT                   /protein_id="ADI03626.1"
FT                   /translation="MPLAGSTLYSPAWFIPFDDYARRVRSAGVAVQLDRFDDEGDGDGA
FT                   WLPLDDVPVRTPSAALAYPGLGRCGEPWAARPRRHRARFAAAGYQPLYPADEQPYSADL
FT                   VGVEFLVYPYDDAHPPAVVTEPRLVRLLPSVSFPYPPGLRTVHGAVVDATTRTPIANAL
FT                   VEARGRTSRDLTPWHERTLSDAAGAFRLALRWEGEKADEHAVEETFRLEATERPGRSGS
FT                   LVVRLPQDIERRHVIEIREQ"
     MPLAGSTLYS PAWFIPFDDY ARRVRSAGVA VQLDRFDDEG DGDGAWLPLD DVPVRTPSAA        60
     LAYPGLGRCG EPWAARPRRH RARFAAAGYQ PLYPADEQPY SADLVGVEFL VYPYDDAHPP       120
     AVVTEPRLVR LLPSVSFPYP PGLRTVHGAV VDATTRTPIA NALVEARGRT SRDLTPWHER       180
     TLSDAAGAFR LALRWEGEKA DEHAVEETFR LEATERPGRS GSLVVRLPQD IERRHVIEIR       240
     EQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page