(data stored in ACNUC7421 zone)

EMBL: CP002047.PE506

CP002047.PE506       Location/Qualifiers
FT   CDS             complement(593306..593884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03627"
FT                   /db_xref="InterPro:IPR025351"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D6"
FT                   /protein_id="ADI03627.1"
FT                   /translation="MGDFGVIADVSTVIVETLTQALRGLSQVEPPIAELNDLSETVQTP
FT                   PPKLTVFLYEIAEDPTSRNRPPVRSQPPDPPNVRKPPMALLLRYLITPWGGDPATQHRM
FT                   LGRALQTFYDDAILDGVQLSGSLAASTDSLHLSLTPLTLDQKSWVWYAIQKPYRLSLNY
FT                   EVRVVNLDSAVETAVRPVNSRAISGAAMP"
     MGDFGVIADV STVIVETLTQ ALRGLSQVEP PIAELNDLSE TVQTPPPKLT VFLYEIAEDP        60
     TSRNRPPVRS QPPDPPNVRK PPMALLLRYL ITPWGGDPAT QHRMLGRALQ TFYDDAILDG       120
     VQLSGSLAAS TDSLHLSLTP LTLDQKSWVW YAIQKPYRLS LNYEVRVVNL DSAVETAVRP       180
     VNSRAISGAA MP                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page