(data stored in ACNUC7421 zone)

EMBL: CP002047.PE507

CP002047.PE507       Location/Qualifiers
FT   CDS             594081..594278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03628"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D7"
FT                   /protein_id="ADI03628.1"
FT                   /translation="MEIPSDRTGVLILRVWVEDGRPDGFRARIVRSGGPHQAPPTAVSA
FT                   VDDVLSAVQAWLDQLLEPDR"
     MEIPSDRTGV LILRVWVEDG RPDGFRARIV RSGGPHQAPP TAVSAVDDVL SAVQAWLDQL        60
     LEPDR                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page