(data stored in ACNUC7421 zone)

EMBL: CP002047.PE508

CP002047.PE508       Location/Qualifiers
FT   CDS             594487..595323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00508"
FT                   /product="transcriptional regulator, SARP family protein"
FT                   /note="COG3629 DNA-binding transcriptional activator of the
FT                   SARP family"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03629"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0D8"
FT                   /protein_id="ADI03629.1"
FT                   /translation="MVDHKRVPVSSSAQRLLAFLALQDMPRTRTYVAGTLWPDVTASRA
FT                   NANLRSSLWRATRTGHQVIDASTQELAISKHIDVDLHTAARHAHCLLDMSRSCDDILTA
FT                   QTRADLSADLLPEWSENEWVLIEQEQYHELRLYALEAMTERLTAAGRHGEAVAAGLAAV
FT                   RAEPLRESAHRALMNAHLTAGNRGAALLQYEQCCRVLHDELGLEPSPTLRNLVSPHTEA
FT                   GALRTPARRVVRHPASDALRDATDEAERVAISPAEPRRLPRSRRAGTGPPMPSHPQ"
     MVDHKRVPVS SSAQRLLAFL ALQDMPRTRT YVAGTLWPDV TASRANANLR SSLWRATRTG        60
     HQVIDASTQE LAISKHIDVD LHTAARHAHC LLDMSRSCDD ILTAQTRADL SADLLPEWSE       120
     NEWVLIEQEQ YHELRLYALE AMTERLTAAG RHGEAVAAGL AAVRAEPLRE SAHRALMNAH       180
     LTAGNRGAAL LQYEQCCRVL HDELGLEPSP TLRNLVSPHT EAGALRTPAR RVVRHPASDA       240
     LRDATDEAER VAISPAEPRR LPRSRRAGTG PPMPSHPQ                               278
//

If you have problems or comments...

PBIL Back to PBIL home page