(data stored in ACNUC7421 zone)

EMBL: CP002047.PE510

CP002047.PE510       Location/Qualifiers
FT   CDS             complement(596938..599853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00510"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03631"
FT                   /db_xref="GOA:D7C0E0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E0"
FT                   /protein_id="ADI03631.1"
FT                   /translation="MASVHPAAPVAADGGDAVLQALGALGTPVDCAGLRRLPLEGPQVL
FT                   WLVAAGALDLFAVDAAEEGQWHFLGRLETGAALPGPVDGPLHTLLGRPSQDCLVRRIPL
FT                   RELYRPEAYDTYDASYGTGHADDPYGPYGTYGTYGMYGGGGVFQDTPPTPLEHAVALGV
FT                   SRSLGVLFQALLDGGAAPDTDAADEDLLWLPVPPGSVRYGAEYSAQAAGDLLIDGALWQ
FT                   RMVNQQYRLGTAVDRWIDTVERAHADRTAAGIRAGEAMRSRADQALIASIGGPRRDRRP
FT                   SEENTDDAVHAVCREVAEAAGITLPGPPRGRAADGRTDPVERIAAHARIRTRAVRLEGR
FT                   WWREDTGPLVGYRAKSGAPVALLWRRGGYEALNPVSGMRIRVGASNAEEFEPRALMFYR
FT                   PLPDRPMTMWRLMRFSARGAAGDARNLLISGLVTVALGALVPLATGQVLGGFVPRAEKS
FT                   PIVQIALALIVSSVVAAAFMLLQNLTLLRLEGRLESTLQPAVWDRLLRLPTTFFARRST
FT                   GELASAALGISAMRRVLSGIAPTVFQAGTVGAMNLALLLYYNASLALAVVAMLLVVSGV
FT                   FLGMGLWQVRWQRRLVESENKLNNQAFQVLRGLPKLRVAAAENFAYAAWARGFAHSRDL
FT                   HQRTGRIKNLTQVLDAVYLPLVSLIVFMLLAGPARGSMSAGAFLTFNTSVTMLLTSLTQ
FT                   LTNALVSVVAVLPLFEQVKPILDEPPEVRGGSAPPGVLSGDLRARNLTFRYGDDGPLVL
FT                   DDVSLEIRPGEFVAVVGPSGCGKSTLLRLLIGFERPVSGSVLYDGQDLAALDQAAVRRQ
FT                   CGVVLQNAQPLGGTVLDCIRGAEPFTPEEAMAAAELAGLAEDIGQMPMGLQTMISGSGA
FT                   ISGGQRQRLMIAQALIRRPRVLFFDEATSALDNETQRIVIDSTRRLNASRLVIAHRLST
FT                   VMDADRVLVMEGGRIVEQGAPAELMAVPGGKLHELVRRQMR"
     MASVHPAAPV AADGGDAVLQ ALGALGTPVD CAGLRRLPLE GPQVLWLVAA GALDLFAVDA        60
     AEEGQWHFLG RLETGAALPG PVDGPLHTLL GRPSQDCLVR RIPLRELYRP EAYDTYDASY       120
     GTGHADDPYG PYGTYGTYGM YGGGGVFQDT PPTPLEHAVA LGVSRSLGVL FQALLDGGAA       180
     PDTDAADEDL LWLPVPPGSV RYGAEYSAQA AGDLLIDGAL WQRMVNQQYR LGTAVDRWID       240
     TVERAHADRT AAGIRAGEAM RSRADQALIA SIGGPRRDRR PSEENTDDAV HAVCREVAEA       300
     AGITLPGPPR GRAADGRTDP VERIAAHARI RTRAVRLEGR WWREDTGPLV GYRAKSGAPV       360
     ALLWRRGGYE ALNPVSGMRI RVGASNAEEF EPRALMFYRP LPDRPMTMWR LMRFSARGAA       420
     GDARNLLISG LVTVALGALV PLATGQVLGG FVPRAEKSPI VQIALALIVS SVVAAAFMLL       480
     QNLTLLRLEG RLESTLQPAV WDRLLRLPTT FFARRSTGEL ASAALGISAM RRVLSGIAPT       540
     VFQAGTVGAM NLALLLYYNA SLALAVVAML LVVSGVFLGM GLWQVRWQRR LVESENKLNN       600
     QAFQVLRGLP KLRVAAAENF AYAAWARGFA HSRDLHQRTG RIKNLTQVLD AVYLPLVSLI       660
     VFMLLAGPAR GSMSAGAFLT FNTSVTMLLT SLTQLTNALV SVVAVLPLFE QVKPILDEPP       720
     EVRGGSAPPG VLSGDLRARN LTFRYGDDGP LVLDDVSLEI RPGEFVAVVG PSGCGKSTLL       780
     RLLIGFERPV SGSVLYDGQD LAALDQAAVR RQCGVVLQNA QPLGGTVLDC IRGAEPFTPE       840
     EAMAAAELAG LAEDIGQMPM GLQTMISGSG AISGGQRQRL MIAQALIRRP RVLFFDEATS       900
     ALDNETQRIV IDSTRRLNAS RLVIAHRLST VMDADRVLVM EGGRIVEQGA PAELMAVPGG       960
     KLHELVRRQM R                                                            971
//

If you have problems or comments...

PBIL Back to PBIL home page