(data stored in ACNUC7421 zone)

EMBL: CP002047.PE511

CP002047.PE511       Location/Qualifiers
FT   CDS             complement(599855..601987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00511"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG2274 ABC-type bacteriocin/lantibiotic exporters,
FT                   contain an N-terminal double-glycine peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03632"
FT                   /db_xref="GOA:D7C0E1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E1"
FT                   /protein_id="ADI03632.1"
FT                   /translation="MLQMEALECGAASLAMVLGHYGRHVPLEELRIACGVSRDGSRAGN
FT                   LLRAARSYGLRAKGMQMEPEALAEEVRAPAILFWNFNHYVVYDGMGRRFGKRGVHIDDP
FT                   DKGRRFVPVEEFNTSFTGVVLVFEPEESFRRGGRRPGVLGALPSRMRGTTGTLLASLLA
FT                   SLLLVAVGAAVPALSRTFIDNFLIGGQDSLLGPLFASMAVAVVLTAVLTGVQQANLLRG
FT                   RIISSTLSSARFLRHLLRLPVTFFAQRSPADLVQRLRSNDTVAETLARDLAAAAVDGVV
FT                   VVLYAFLLWTYDPQLTLVGVGLALLNVVAMRVVIRLRATRTQKLRADIARLTTTSYTGL
FT                   QLIETVKATGGETGYFRRWAGQHAITLEEQQRLGVPSAVLAVVAPTLATLNSALILWIG
FT                   GLRAVEGHISIGLLVAFQALVARFTAPITRLNGVAGRIQDFSADVARLKDVENFPADSL
FT                   YTRDEPRADTRRLTGQVTLENITFGYSPLDQPLLRDFSLSVGPGRQVALVGASGSGKST
FT                   VSRLVSGLYTPWEGVIRIDGQRLEDIPRGALAASVSFVDQDVFLFEGTVRDNVALWDPS
FT                   IPDDAVVDALRDAALYDDVIARRPEGIHCRVEQDGRNFSGGQRQRLEIARALVRRPSVL
FT                   VLDEVTSALDARTEQIVMDSLRRRGCACVVIAHRLSTVRDSDEILVLNRGTVVERGRHE
FT                   DLAAAGGPYAELMKEH"
     MLQMEALECG AASLAMVLGH YGRHVPLEEL RIACGVSRDG SRAGNLLRAA RSYGLRAKGM        60
     QMEPEALAEE VRAPAILFWN FNHYVVYDGM GRRFGKRGVH IDDPDKGRRF VPVEEFNTSF       120
     TGVVLVFEPE ESFRRGGRRP GVLGALPSRM RGTTGTLLAS LLASLLLVAV GAAVPALSRT       180
     FIDNFLIGGQ DSLLGPLFAS MAVAVVLTAV LTGVQQANLL RGRIISSTLS SARFLRHLLR       240
     LPVTFFAQRS PADLVQRLRS NDTVAETLAR DLAAAAVDGV VVVLYAFLLW TYDPQLTLVG       300
     VGLALLNVVA MRVVIRLRAT RTQKLRADIA RLTTTSYTGL QLIETVKATG GETGYFRRWA       360
     GQHAITLEEQ QRLGVPSAVL AVVAPTLATL NSALILWIGG LRAVEGHISI GLLVAFQALV       420
     ARFTAPITRL NGVAGRIQDF SADVARLKDV ENFPADSLYT RDEPRADTRR LTGQVTLENI       480
     TFGYSPLDQP LLRDFSLSVG PGRQVALVGA SGSGKSTVSR LVSGLYTPWE GVIRIDGQRL       540
     EDIPRGALAA SVSFVDQDVF LFEGTVRDNV ALWDPSIPDD AVVDALRDAA LYDDVIARRP       600
     EGIHCRVEQD GRNFSGGQRQ RLEIARALVR RPSVLVLDEV TSALDARTEQ IVMDSLRRRG       660
     CACVVIAHRL STVRDSDEIL VLNRGTVVER GRHEDLAAAG GPYAELMKEH                  710
//

If you have problems or comments...

PBIL Back to PBIL home page