(data stored in ACNUC7421 zone)

EMBL: CP002047.PE512

CP002047.PE512       Location/Qualifiers
FT   CDS             complement(602146..602952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00512"
FT                   /product="hypothetical protein"
FT                   /note="COG0845 Membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03633"
FT                   /db_xref="GOA:D7C0E2"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E2"
FT                   /protein_id="ADI03633.1"
FT                   /translation="MQFRQQALAKLQSAEDIDLPVRYARPQGWLALAVTLVVMAGAAVW
FT                   AVTGTVSNTLETTGILTHGQGSYVLQSPIAGQVTSVLAQEGSTLRAGAPLLKVRTARGT
FT                   TVVRTIAAGRLTTLSVSIGSVLATGANVASVERVRHSGDPLVATLYVPADRAASVRPGA
FT                   SVDLSVQSVPTQTYGVLRGEVQTVGRTALSRQQIGSYLGAEQLGEEFSKHGPPVAVQVR
FT                   LHRTSATRSGYRWSSPEGPPFSLGSMTLANGTIHLAAHHPIDWLLP"
     MQFRQQALAK LQSAEDIDLP VRYARPQGWL ALAVTLVVMA GAAVWAVTGT VSNTLETTGI        60
     LTHGQGSYVL QSPIAGQVTS VLAQEGSTLR AGAPLLKVRT ARGTTVVRTI AAGRLTTLSV       120
     SIGSVLATGA NVASVERVRH SGDPLVATLY VPADRAASVR PGASVDLSVQ SVPTQTYGVL       180
     RGEVQTVGRT ALSRQQIGSY LGAEQLGEEF SKHGPPVAVQ VRLHRTSATR SGYRWSSPEG       240
     PPFSLGSMTL ANGTIHLAAH HPIDWLLP                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page