(data stored in ACNUC7421 zone)

EMBL: CP002047.PE513

CP002047.PE513       Location/Qualifiers
FT   CDS             complement(603067..603279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03634"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E3"
FT                   /protein_id="ADI03634.1"
FT                   /translation="MNNAPKVATQEISDAELDNVAGGLGVVGDALGTVDSLTGAVGTVG
FT                   LATSTVDGVTGLNTTGIVGGVVTTL"
     MNNAPKVATQ EISDAELDNV AGGLGVVGDA LGTVDSLTGA VGTVGLATST VDGVTGLNTT        60
     GIVGGVVTTL                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page