(data stored in ACNUC7421 zone)

EMBL: CP002047.PE514

CP002047.PE514       Location/Qualifiers
FT   CDS             604206..604688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00514"
FT                   /product="urease accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03635"
FT                   /db_xref="GOA:D7C0E4"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E4"
FT                   /protein_id="ADI03635.1"
FT                   /translation="MIWLPQSLISTRGSTLHQTYTVDVAASSRLLLREEQLLGRTAEPP
FT                   GHLTTRLTVRRAGRLILDQHTTYGVPALAWDGPAVLGGHRACGQLLVVTPEPHPLEEPV
FT                   HLGEDPADGCAVLAPLADSRALLTTAIAPTPARLRLLLDAALAVGVPAMRCGRRGS"
     MIWLPQSLIS TRGSTLHQTY TVDVAASSRL LLREEQLLGR TAEPPGHLTT RLTVRRAGRL        60
     ILDQHTTYGV PALAWDGPAV LGGHRACGQL LVVTPEPHPL EEPVHLGEDP ADGCAVLAPL       120
     ADSRALLTTA IAPTPARLRL LLDAALAVGV PAMRCGRRGS                             160
//

If you have problems or comments...

PBIL Back to PBIL home page