(data stored in ACNUC7421 zone)

EMBL: CP002047.PE518

CP002047.PE518       Location/Qualifiers
FT   CDS             606974..607375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00518"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03639"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0E8"
FT                   /protein_id="ADI03639.1"
FT                   /translation="MIVNILRFSFKDGTTDEKKAEVLGAMRRTAAVESASFATVGQDLG
FT                   DPAEGYTHAYCVGIADLPALERYMYDPVHLEGDFEILPHLARLSAVRLSDDMDPELGAR
FT                   VTEIFLAKVAKYPEWGELLNSIPDTRIST"
     MIVNILRFSF KDGTTDEKKA EVLGAMRRTA AVESASFATV GQDLGDPAEG YTHAYCVGIA        60
     DLPALERYMY DPVHLEGDFE ILPHLARLSA VRLSDDMDPE LGARVTEIFL AKVAKYPEWG       120
     ELLNSIPDTR IST                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page