(data stored in ACNUC7421 zone)

EMBL: CP002047.PE52

CP002047.PE52        Location/Qualifiers
FT   CDS             complement(49604..49783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03173"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI2"
FT                   /protein_id="ADI03173.1"
FT                   /translation="MALRPVQVNIATTSAAHQAELVASLQALGATPAHAGQGQVPWTVL
FT                   ADPEGHEFCLLAPS"
     MALRPVQVNI ATTSAAHQAE LVASLQALGA TPAHAGQGQV PWTVLADPEG HEFCLLAPS         59
//

If you have problems or comments...

PBIL Back to PBIL home page