(data stored in ACNUC7421 zone)

EMBL: CP002047.PE520

CP002047.PE520       Location/Qualifiers
FT   CDS             608640..609206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03641"
FT                   /db_xref="InterPro:IPR022598"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F0"
FT                   /protein_id="ADI03641.1"
FT                   /translation="MTAGPLARPTAGTVTAHPDDPALRERVLRPYRTNCRYLGPAEVRL
FT                   ENEAVTASGTFRIGESCYIDDTGHFNAVEFNICFNQIAYYLIAKCAQNRLPPVFAAWTL
FT                   DDYWQRQLSDILITRFTSRFHRAIRGQEFRGELSFTDFKLRSGENGRAPLALIESECRF
FT                   WDKGGGRCTGEIQIALTNLPQGAPR"
     MTAGPLARPT AGTVTAHPDD PALRERVLRP YRTNCRYLGP AEVRLENEAV TASGTFRIGE        60
     SCYIDDTGHF NAVEFNICFN QIAYYLIAKC AQNRLPPVFA AWTLDDYWQR QLSDILITRF       120
     TSRFHRAIRG QEFRGELSFT DFKLRSGENG RAPLALIESE CRFWDKGGGR CTGEIQIALT       180
     NLPQGAPR                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page