(data stored in ACNUC7421 zone)

EMBL: CP002047.PE527

CP002047.PE527       Location/Qualifiers
FT   CDS             complement(620299..621843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03648"
FT                   /db_xref="GOA:D7C0F7"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F7"
FT                   /protein_id="ADI03648.1"
FT                   /translation="MSDILTFIIVPALYLALLLLYLVFVPVIAALRGAALVSELLWRYC
FT                   RLLGGVLRLRTPEFVTIPPYRPADERAHRNYFFGPATRDLRQLLTLGRRLYVRTVTDAY
FT                   RRVTADQFTAPSTHRSASVPYGLTLYLGLGVGAAAAAPVLGLLLGLHALGVALLTLGAR
FT                   LTALTLRAADRAVMILRGLPRGMLCPSCFERVPYPAYDCPRTTCRRRHADIRPGTFGLF
FT                   RRRCACDERIPTLLMLMSRDARLSGHCVHEHCGKPMNPDAGHMPELILPLIGGRAAGKT
FT                   QLMAAMVKALENTAENGGPAIRLADPESTANQRVLNEVLEIQGHTRPTQKTLPRAHSFV
FT                   RGSGRAERLVHVFDTAGERFVNREETDALRYIREARTFVFVLDPMAVGAFWTRLDPAGP
FT                   KVDRTLASTVDPEDVFSRSVQTVRTMGTRLDKARLAVAVSKRDLMTGQSALLPDRPDHS
FT                   DTTRDWLCERLGLRNLLKTMDLEFGEVRFFCTAAVADEEGRVDPSIGVFVDWCLRE"
     MSDILTFIIV PALYLALLLL YLVFVPVIAA LRGAALVSEL LWRYCRLLGG VLRLRTPEFV        60
     TIPPYRPADE RAHRNYFFGP ATRDLRQLLT LGRRLYVRTV TDAYRRVTAD QFTAPSTHRS       120
     ASVPYGLTLY LGLGVGAAAA APVLGLLLGL HALGVALLTL GARLTALTLR AADRAVMILR       180
     GLPRGMLCPS CFERVPYPAY DCPRTTCRRR HADIRPGTFG LFRRRCACDE RIPTLLMLMS       240
     RDARLSGHCV HEHCGKPMNP DAGHMPELIL PLIGGRAAGK TQLMAAMVKA LENTAENGGP       300
     AIRLADPEST ANQRVLNEVL EIQGHTRPTQ KTLPRAHSFV RGSGRAERLV HVFDTAGERF       360
     VNREETDALR YIREARTFVF VLDPMAVGAF WTRLDPAGPK VDRTLASTVD PEDVFSRSVQ       420
     TVRTMGTRLD KARLAVAVSK RDLMTGQSAL LPDRPDHSDT TRDWLCERLG LRNLLKTMDL       480
     EFGEVRFFCT AAVADEEGRV DPSIGVFVDW CLRE                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page