(data stored in ACNUC7421 zone)

EMBL: CP002047.PE528

CP002047.PE528       Location/Qualifiers
FT   CDS             complement(621851..624298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03649"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F8"
FT                   /protein_id="ADI03649.1"
FT                   /translation="MSFQQLYYTSCEHGLSPSAGFQFNAVSEQVSAETRLRVEGLAGYE
FT                   PPRSLAESDTPELLARCPVNLCHTPDPQGGATTLCVRYVGRDSARRFGNYFAHALYNEG
FT                   EFTPDSGGLLAIELWDSPVWTARVAETTEIPELPAPLPRGPLSPRSARAFLRAHPHAEQ
FT                   LPALLAAVFAALAEDGSVVVIDDTTDRIAHWFAAVSYLLPPPLARTLSFATYLFRPTRS
FT                   RLHLIGTVPGAQPDFGPDDEESYTVFDFSAGRFPEVVPTHHLVRLLTRIGVGAIRSVWS
FT                   WTAEYTHGQERALGDWHAPVAAAAAAGGTELTDADIRAVIDWLPGAGHLGPRRAAVAAD
FT                   IHHTHRDLDDDQLAALSAAAETGGDTALHHELEGKLHQSRIRAYVTGVENAPGPVPITH
FT                   PTERERATALWQRMLGEAANSRQQVRLLLWAVGARLAPPPELLTAQSLDLARALLGSSG
FT                   AGPGLREEVAHLVHTLPEFRAGLATAAQEVLDERGGQEQLFAQFPATLLSERDLGERPR
FT                   LLEYYWRAQAERQPARTVGLLFRILEVRGQASPDAELLRGLWRQPSPAWTYEEATEIAR
FT                   RLPSDQPVDEAVAEWFDRAVKQEVRDEEGLRACLVLCDTLTAPGRDAWLRAVTRECVRT
FT                   TLQLDTALREATEATALARAFRIPQIDAWAAPRALKHYRLLPAMLRLPVDPARLRTEIG
FT                   EFGFSLADGYLRSVYQAAVTSDRGHVDGVLFSQVTGVIAINYERVPLPLAHVEIVRGLR
FT                   RHTAEHWRYEDLDRLARALRPYSARLADEYQQHADNRLGRVKKWRRKLTQRRPSDGPRP
FT                   EGG"
     MSFQQLYYTS CEHGLSPSAG FQFNAVSEQV SAETRLRVEG LAGYEPPRSL AESDTPELLA        60
     RCPVNLCHTP DPQGGATTLC VRYVGRDSAR RFGNYFAHAL YNEGEFTPDS GGLLAIELWD       120
     SPVWTARVAE TTEIPELPAP LPRGPLSPRS ARAFLRAHPH AEQLPALLAA VFAALAEDGS       180
     VVVIDDTTDR IAHWFAAVSY LLPPPLARTL SFATYLFRPT RSRLHLIGTV PGAQPDFGPD       240
     DEESYTVFDF SAGRFPEVVP THHLVRLLTR IGVGAIRSVW SWTAEYTHGQ ERALGDWHAP       300
     VAAAAAAGGT ELTDADIRAV IDWLPGAGHL GPRRAAVAAD IHHTHRDLDD DQLAALSAAA       360
     ETGGDTALHH ELEGKLHQSR IRAYVTGVEN APGPVPITHP TERERATALW QRMLGEAANS       420
     RQQVRLLLWA VGARLAPPPE LLTAQSLDLA RALLGSSGAG PGLREEVAHL VHTLPEFRAG       480
     LATAAQEVLD ERGGQEQLFA QFPATLLSER DLGERPRLLE YYWRAQAERQ PARTVGLLFR       540
     ILEVRGQASP DAELLRGLWR QPSPAWTYEE ATEIARRLPS DQPVDEAVAE WFDRAVKQEV       600
     RDEEGLRACL VLCDTLTAPG RDAWLRAVTR ECVRTTLQLD TALREATEAT ALARAFRIPQ       660
     IDAWAAPRAL KHYRLLPAML RLPVDPARLR TEIGEFGFSL ADGYLRSVYQ AAVTSDRGHV       720
     DGVLFSQVTG VIAINYERVP LPLAHVEIVR GLRRHTAEHW RYEDLDRLAR ALRPYSARLA       780
     DEYQQHADNR LGRVKKWRRK LTQRRPSDGP RPEGG                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page