(data stored in ACNUC7421 zone)

EMBL: CP002047.PE529

CP002047.PE529       Location/Qualifiers
FT   CDS             complement(624295..625485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0F9"
FT                   /protein_id="ADI03650.1"
FT                   /translation="MARRLTCPYCYETFAPREIRFRCNSRLSRTRKQCQRRRDPVLDER
FT                   FGRRPSHDVGPDFAADGRKSTAVCPDCDGETTYRICPVCHVELPVQFGMVENRLIAMVG
FT                   ARSSGKTIYMTVLLHEMRHKIGEAFGASLMGLDDTTMRRYSSEYEDRLYRDRQMFPPTQ
FT                   TATTNANRVEPLVFRFGLRRRGLFGERPQHSVLSFFDTAGEDFNSRESVELNTRYLTNA
FT                   DGIILLLDPLQMPGARDSAAPGTALPGEDGIDPPINVLSRVSGMLLAAQGGKAAKVDTP
FT                   IAVVFSKMDAFWHLMENGSPLRSHAPALGRFDVGDSLSVHEEVRQLLREWDGVPVDQSL
FT                   ENTFARYRYFGVSALGRSATPESRVADTGIQPYRVADPLLWLLSEFGSVPKAGRGR"
     MARRLTCPYC YETFAPREIR FRCNSRLSRT RKQCQRRRDP VLDERFGRRP SHDVGPDFAA        60
     DGRKSTAVCP DCDGETTYRI CPVCHVELPV QFGMVENRLI AMVGARSSGK TIYMTVLLHE       120
     MRHKIGEAFG ASLMGLDDTT MRRYSSEYED RLYRDRQMFP PTQTATTNAN RVEPLVFRFG       180
     LRRRGLFGER PQHSVLSFFD TAGEDFNSRE SVELNTRYLT NADGIILLLD PLQMPGARDS       240
     AAPGTALPGE DGIDPPINVL SRVSGMLLAA QGGKAAKVDT PIAVVFSKMD AFWHLMENGS       300
     PLRSHAPALG RFDVGDSLSV HEEVRQLLRE WDGVPVDQSL ENTFARYRYF GVSALGRSAT       360
     PESRVADTGI QPYRVADPLL WLLSEFGSVP KAGRGR                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page