(data stored in ACNUC7421 zone)

EMBL: CP002047.PE530

CP002047.PE530       Location/Qualifiers
FT   CDS             complement(625486..627171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00530"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="COG0443 Molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03651"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G0"
FT                   /protein_id="ADI03651.1"
FT                   /translation="MLGIAIGHRIARFGRLGPEGRPTVTATDLAGTDGVADPATALTTL
FT                   LAEVTGEEAVATGEEAVLGLPASAGREAEADLRRAAKDAGLRVNRIVPEPVAVALHYGA
FT                   IDEGVHRTVLVVDQAATTVDLTVLAITPDLTVRIVTTRTEQLADDHALTAIAQELTEAA
FT                   PDAVLLSGDLYTTPAHRTDIENLADVQGLTMRCRAPELAVVHGLLLLEDFGLLRIATGP
FT                   APARAHFPPPLEDPEPQPWPTPAVDPEPQNAPPDNALKGRGAMTAPPRGREQPPPPDSE
FT                   PLTATGPNGRGAVTAPPRGPERPPPPHSEPPTATTPPIPTPEPEPEPELELETPRREPA
FT                   PTLRSVPVTQLEAIRRDDHLLVLWAWPDSALTARVRWRREDVTTAGDGPRDGDIRCQRR
FT                   VYEHDGGLDLPVGRGAVTLTVEALVPDPAVDTEGAASLRIPAEPPIVEYEPSLRRRLTG
FT                   ARVATVTFTARTGCDLPALRIVHGLGRYRPTSTAEGTVLHEVPAQRLPAGAPLIVEFPL
FT                   PSTKGPSWLVCFPVDGPDSGPDSGQDHDIDIDIRPTALHRLRVT"
     MLGIAIGHRI ARFGRLGPEG RPTVTATDLA GTDGVADPAT ALTTLLAEVT GEEAVATGEE        60
     AVLGLPASAG REAEADLRRA AKDAGLRVNR IVPEPVAVAL HYGAIDEGVH RTVLVVDQAA       120
     TTVDLTVLAI TPDLTVRIVT TRTEQLADDH ALTAIAQELT EAAPDAVLLS GDLYTTPAHR       180
     TDIENLADVQ GLTMRCRAPE LAVVHGLLLL EDFGLLRIAT GPAPARAHFP PPLEDPEPQP       240
     WPTPAVDPEP QNAPPDNALK GRGAMTAPPR GREQPPPPDS EPLTATGPNG RGAVTAPPRG       300
     PERPPPPHSE PPTATTPPIP TPEPEPEPEL ELETPRREPA PTLRSVPVTQ LEAIRRDDHL       360
     LVLWAWPDSA LTARVRWRRE DVTTAGDGPR DGDIRCQRRV YEHDGGLDLP VGRGAVTLTV       420
     EALVPDPAVD TEGAASLRIP AEPPIVEYEP SLRRRLTGAR VATVTFTART GCDLPALRIV       480
     HGLGRYRPTS TAEGTVLHEV PAQRLPAGAP LIVEFPLPST KGPSWLVCFP VDGPDSGPDS       540
     GQDHDIDIDI RPTALHRLRV T                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page