(data stored in ACNUC7421 zone)

EMBL: CP002047.PE531

CP002047.PE531       Location/Qualifiers
FT   CDS             complement(627176..629179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00531"
FT                   /product="ATPase AAA-2"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03652"
FT                   /db_xref="GOA:D7C0G1"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G1"
FT                   /protein_id="ADI03652.1"
FT                   /translation="MDDPVNTVDFTKDEDGTGPVTADGMMPLWAVSLGWELRRGRQVIL
FT                   NGQIRDRWWFEDRPVTFRELVAGVLEARGADVVGWWDPVAGLTFPLPGHAERFAQLDAD
FT                   RPRAATRSDGRDTPADNGRGTPRDTPANDRPRTTPRGRGGSERERDRSSLLSPRPAGPP
FT                   RAFDDVVATVHRLAASPDAATAFVFQDVDHHLPPGQMESNPGYLRLRAAMTDAVTPRPT
FT                   PAGRRPHARNAVLCAVGDVGRLPGWFHLEDPRIATLHIGPPDPSERRLWLTWLRGDFNG
FT                   APDATRHDIEALVGATDGMSGWDIDALARTSWLRDAPLQKPDKLLELHRLNVSVDPWTQ
FT                   LDRETVARAADVLGARVVGQSKAVDAVAAALQAAFVGIDFGGSGTARPRGAFFFVGPTG
FT                   VGKTELAKAVAELMFGDQSAYARFDMSEYQQEHAAERLAGAPPGFIGHEQGGELTRRVQ
FT                   ERPFSVLLFDEIEKAHPRVLDKFLQILEDGRLTDGRGQTAYFSQCLIIFTSNTGAEAVQ
FT                   DLLSEGDEEVPYSVLEAHFTRAVEEKFRAMGRPEIYGRLKPGVVVFDMLRRAHIVKIAD
FT                   RLLGQLTESVRERHQAELVADTDTLHPWITERMSDPEHQAYGGRQIRNELERLRAAVVS
FT                   HFLAHRPTPGSRIRLGIEDDGTPWVRTEEGNG"
     MDDPVNTVDF TKDEDGTGPV TADGMMPLWA VSLGWELRRG RQVILNGQIR DRWWFEDRPV        60
     TFRELVAGVL EARGADVVGW WDPVAGLTFP LPGHAERFAQ LDADRPRAAT RSDGRDTPAD       120
     NGRGTPRDTP ANDRPRTTPR GRGGSERERD RSSLLSPRPA GPPRAFDDVV ATVHRLAASP       180
     DAATAFVFQD VDHHLPPGQM ESNPGYLRLR AAMTDAVTPR PTPAGRRPHA RNAVLCAVGD       240
     VGRLPGWFHL EDPRIATLHI GPPDPSERRL WLTWLRGDFN GAPDATRHDI EALVGATDGM       300
     SGWDIDALAR TSWLRDAPLQ KPDKLLELHR LNVSVDPWTQ LDRETVARAA DVLGARVVGQ       360
     SKAVDAVAAA LQAAFVGIDF GGSGTARPRG AFFFVGPTGV GKTELAKAVA ELMFGDQSAY       420
     ARFDMSEYQQ EHAAERLAGA PPGFIGHEQG GELTRRVQER PFSVLLFDEI EKAHPRVLDK       480
     FLQILEDGRL TDGRGQTAYF SQCLIIFTSN TGAEAVQDLL SEGDEEVPYS VLEAHFTRAV       540
     EEKFRAMGRP EIYGRLKPGV VVFDMLRRAH IVKIADRLLG QLTESVRERH QAELVADTDT       600
     LHPWITERMS DPEHQAYGGR QIRNELERLR AAVVSHFLAH RPTPGSRIRL GIEDDGTPWV       660
     RTEEGNG                                                                 667
//

If you have problems or comments...

PBIL Back to PBIL home page