(data stored in ACNUC7421 zone)

EMBL: CP002047.PE532

CP002047.PE532       Location/Qualifiers
FT   CDS             complement(629164..630597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03653"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G2"
FT                   /protein_id="ADI03653.1"
FT                   /translation="MSGSPKYSSVRVGAVYAQREAAERRRRAEQRRARERRRAAERARL
FT                   AQEAAARRERARAETERRRAEAARKEAEVAARRTAERGARLAQARAEESRADERGLDEV
FT                   WELIAEAQRSGARAETGSLERQLAELRGRAARGEQLGDAVEELRGRVVNLRPTAAGDRT
FT                   DDSAAVLAGLERRFSATGPDGAALDADGHRRCTDLLDQLRAAAGPGRQVRFEALLGTVE
FT                   HALARHAATVSEAREATVRQARAEQEREAAEAAERERAEAAEAALELALAEAAERFDVV
FT                   RPAAEGVLDTAAELGDPGLADEIGDALRAVTEALTARSASEARRAVADLEGRLPDAEDR
FT                   LDELELAYQRRRDLVEALRDAMTGEGFAFEGGEDQGGSFRLHFTRPTGATYETTVASED
FT                   DGTPVLVYHVEGEPDVTLYAPQDEAVCDTTEALLERVHEALGGDDGFVPGELTWDGKPP
FT                   PGTGGNQLPGGTSGRWTTP"
     MSGSPKYSSV RVGAVYAQRE AAERRRRAEQ RRARERRRAA ERARLAQEAA ARRERARAET        60
     ERRRAEAARK EAEVAARRTA ERGARLAQAR AEESRADERG LDEVWELIAE AQRSGARAET       120
     GSLERQLAEL RGRAARGEQL GDAVEELRGR VVNLRPTAAG DRTDDSAAVL AGLERRFSAT       180
     GPDGAALDAD GHRRCTDLLD QLRAAAGPGR QVRFEALLGT VEHALARHAA TVSEAREATV       240
     RQARAEQERE AAEAAERERA EAAEAALELA LAEAAERFDV VRPAAEGVLD TAAELGDPGL       300
     ADEIGDALRA VTEALTARSA SEARRAVADL EGRLPDAEDR LDELELAYQR RRDLVEALRD       360
     AMTGEGFAFE GGEDQGGSFR LHFTRPTGAT YETTVASEDD GTPVLVYHVE GEPDVTLYAP       420
     QDEAVCDTTE ALLERVHEAL GGDDGFVPGE LTWDGKPPPG TGGNQLPGGT SGRWTTP          477
//

If you have problems or comments...

PBIL Back to PBIL home page