(data stored in ACNUC7421 zone)

EMBL: CP002047.PE533

CP002047.PE533       Location/Qualifiers
FT   CDS             complement(630594..631238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00533"
FT                   /product="putative radical activating enzyme"
FT                   /note="COG0602 Organic radical activating enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03654"
FT                   /db_xref="GOA:D7C0G3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G3"
FT                   /protein_id="ADI03654.1"
FT                   /translation="MTTHLSVARTLDRCTVLGPATRAVIWVQGCPLRCQGCVAAETLPF
FT                   EGGTSRSVAELADWLCRLDGIEGVTFSGGEPFSQAGALAELLDAVRERRPDFGAMAYSG
FT                   FRHEALRRGDPDRLALLERLDLLVDGPYRAPLHGSLRWRGSENQRLIPLTDRYTRALAE
FT                   PDTTAGIELSVDADGSLSWAGVPPTPGFREGLEKQLAARGFVLHTEARRER"
     MTTHLSVART LDRCTVLGPA TRAVIWVQGC PLRCQGCVAA ETLPFEGGTS RSVAELADWL        60
     CRLDGIEGVT FSGGEPFSQA GALAELLDAV RERRPDFGAM AYSGFRHEAL RRGDPDRLAL       120
     LERLDLLVDG PYRAPLHGSL RWRGSENQRL IPLTDRYTRA LAEPDTTAGI ELSVDADGSL       180
     SWAGVPPTPG FREGLEKQLA ARGFVLHTEA RRER                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page