(data stored in ACNUC7421 zone)

EMBL: CP002047.PE534

CP002047.PE534       Location/Qualifiers
FT   CDS             complement(631235..632317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00534"
FT                   /product="hypothetical protein"
FT                   /note="COG4248 Uncharacterized protein with protein kinase
FT                   and helix-hairpin-helix DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03655"
FT                   /db_xref="GOA:D7C0G4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G4"
FT                   /protein_id="ADI03655.1"
FT                   /translation="MTVGLTVVSGSGHTWRLTEQIGSGAEGFVYGVDDGRPLVAKLVPD
FT                   PPDPEAYRRRVARLVRQRREPRTVGLLSGTPVRLAWPLVPVRTGGGTGSDRVDGYVMTD
FT                   MRHAYQPFSRLLTVSTRTAFLPRATWATALHAARALARLLGELHTEGYVVGDLKPDNLW
FT                   VDETGRVGMADVDSWQFTDGREVFPGRMRTPGYTAPERIGAPAGTPPDTASDEFALAVL
FT                   VHQLLMAGLHPFAGHPADGGDYLSYDDNVAHGRCRIVDRTSVLLPRSVPPADLLPRRLA
FT                   ELFRTAFGPARRRPTAAEWAQALAAELAPGRLKACAVNARHLHTVERPWCPWCDQAERG
FT                   ADSYPGGGADGHPGRPQEEA"
     MTVGLTVVSG SGHTWRLTEQ IGSGAEGFVY GVDDGRPLVA KLVPDPPDPE AYRRRVARLV        60
     RQRREPRTVG LLSGTPVRLA WPLVPVRTGG GTGSDRVDGY VMTDMRHAYQ PFSRLLTVST       120
     RTAFLPRATW ATALHAARAL ARLLGELHTE GYVVGDLKPD NLWVDETGRV GMADVDSWQF       180
     TDGREVFPGR MRTPGYTAPE RIGAPAGTPP DTASDEFALA VLVHQLLMAG LHPFAGHPAD       240
     GGDYLSYDDN VAHGRCRIVD RTSVLLPRSV PPADLLPRRL AELFRTAFGP ARRRPTAAEW       300
     AQALAAELAP GRLKACAVNA RHLHTVERPW CPWCDQAERG ADSYPGGGAD GHPGRPQEEA       360
//

If you have problems or comments...

PBIL Back to PBIL home page