(data stored in ACNUC7421 zone)

EMBL: CP002047.PE536

CP002047.PE536       Location/Qualifiers
FT   CDS             complement(633081..633851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00536"
FT                   /product="von Willebrand factor type A"
FT                   /note="COG4245 Uncharacterized protein encoded in toxicity
FT                   protection region of plasmid R478, contains von Willebrand
FT                   factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03657"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G6"
FT                   /protein_id="ADI03657.1"
FT                   /translation="MSVHSIEFGAGFEERQPVVLLLDTSASMGRPEEHPRIDELNGALT
FT                   RWFDGVRGQERLRNRVEVCLITFDSAVRVHDPGPGRLVPVEEADADRVFVPVDSMRPPT
FT                   LRAEGLTRLTEAVEAALELVRTRYRTLQRQRVPVRRPFLWVLTDGAPSDAQGRPLDATA
FT                   LAGTAGRVLEGEEQGEWVFQVIGVRGADLPMLRVLAPKATSALENLDFGRILDLLFQST
FT                   DDSSPDRTADLIHQDIDDRAARLARMERLERDLR"
     MSVHSIEFGA GFEERQPVVL LLDTSASMGR PEEHPRIDEL NGALTRWFDG VRGQERLRNR        60
     VEVCLITFDS AVRVHDPGPG RLVPVEEADA DRVFVPVDSM RPPTLRAEGL TRLTEAVEAA       120
     LELVRTRYRT LQRQRVPVRR PFLWVLTDGA PSDAQGRPLD ATALAGTAGR VLEGEEQGEW       180
     VFQVIGVRGA DLPMLRVLAP KATSALENLD FGRILDLLFQ STDDSSPDRT ADLIHQDIDD       240
     RAARLARMER LERDLR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page